DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp86D

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:283 Identity:58/283 - (20%)
Similarity:108/283 - (38%) Gaps:70/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TCSKNALIALNILYVMIGFLLIGVGVYA---------------RAASIVTNLPIVGGILACGVIL 55
            :|.|..:..||.|:.:.|.||:.:||||               ....::.|:.:|  ::..|||:
  Fly    29 SCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLV--MIIAGVIV 91

  Fly    56 ICISMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLA----VNSEQQQQFAEQGWMTVPT 116
            ..:|..|..||::.:..:|..|.:.|.:.|:::.|:|..|..    :||..:.||.::...:...
  Fly    92 FTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSYRD 156

  Fly   117 DLRKQ-----VQDSLKCCG--------------FNATAPSTTSVVPP------SNEPSCELINQQ 156
            |...|     .|....|||              ||.::||......|      :.:.|..|:|..
  Fly   157 DSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISSGLVNIM 221

  Fly   157 C-------CAHSSEPDCRCEPCGPLLEDKIDYAFKLCGGLGIFFSFTEVLAVFLARRYRNQHD-- 212
            |       ...::........|..::...::....:..|:.:..:..::..::||:....|.|  
  Fly   222 CGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLAKTLEGQIDLQ 286

  Fly   213 -------PCYLPARAVFPHDYLY 228
                   .|:        |.|||
  Fly   287 KSRWSXVQCH--------HPYLY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 49/247 (20%)
tetraspanin_LEL <121..177 CDD:243179 15/87 (17%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 43/233 (18%)
penumbra_like_LEL 132..255 CDD:239411 20/122 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.