DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp66E

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:248 Identity:50/248 - (20%)
Similarity:81/248 - (32%) Gaps:77/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GFTCSKNALIALNILYVMIGFLLIGVGVYARA--ASIVTNLPIVGG------------------I 48
            |..|:|..|...|.::.::|.::.|||::...  .|::..|.:|..                  :
  Fly     6 GVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVL 70

  Fly    49 LACGVILICISMLGLAGAVKHHQVMLFFYMIILFMLFL-----------------------IQFS 90
            |..|.::..:|.||..||::..:.:|..|...|.:|.:                       :|.:
  Fly    71 LVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTT 135

  Fly    91 IASSCLAVNSEQQQQFAEQGWMTVPTDLRKQVQDSLKCCGFNATAPSTTSVVPPS--NEPSCELI 153
            |.|..|..|.:.....    |        .|:..:..|||.|.......|   |:  |......|
  Fly   136 ITSYSLGENVDATSLM----W--------NQLMGNFGCCGINDYHDFDAS---PAWVNGKGNRTI 185

  Fly   154 NQQCCAHSS-------EPDCRCEPCGPLLEDKIDYAFKLCGGLGIFFSFTEVL 199
            ...||....       :.||...|     .|...:..|     |.:..|||.|
  Fly   186 PDACCILKDVAKLVPRDEDCTTNP-----SDSNSFYKK-----GCYEVFTEWL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 49/245 (20%)
tetraspanin_LEL <121..177 CDD:243179 14/64 (22%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 49/245 (20%)
uroplakin_I_like_LEL 116..231 CDD:239409 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442885
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.