DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and TM4SF

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:186 Identity:40/186 - (21%)
Similarity:66/186 - (35%) Gaps:40/186 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CSKNALIALNILYVMIG--------FLLIGVGVYARAASIVTN-LPIVGGILAC-GVILICISML 61
            |.|..:.:..:|..:.|        .||.|..||   ..||.| |.....||.| |.:...:..:
  Fly     9 CFKYLVYSYVVLLALTGAAQIFLGTSLLWGHSVY---YGIVQNKLWAPAAILLCLGPVTFILCWM 70

  Fly    62 GLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVN-----------SEQQQQFAEQGWMTVP 115
            |.....:..:.:|..:..:|.....:||.|....||:.           .:...:|.::...|..
  Fly    71 GCQATNQRKRCLLGMFAALLVACICVQFIICGWSLAMRENLPTSVEIFIDDSFVEFLDKFSRTKV 135

  Fly   116 TDLR--KQVQDSLKCCGFNATAPSTTSVVPPSNEPSCELINQQCCA---HSSEPDC 166
            .:|.  .::|..|:|||.:.........:|.|           ||:   |:.|..|
  Fly   136 DNLHLWNRMQSQLQCCGVDGPLDYRRLSLPWS-----------CCSRPEHAYESAC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 40/186 (22%)
tetraspanin_LEL <121..177 CDD:243179 12/49 (24%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 40/186 (22%)
uroplakin_I_like_LEL 111..197 CDD:239409 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.