DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:241 Identity:49/241 - (20%)
Similarity:81/241 - (33%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CSKNALIALNILYVMIGFLLIGVGVY---------ARAASIVTNLPIVGGILACGVILICISMLG 62
            |.:...:..:.|.:::|.|....|||         |........|.:.|.::..|::       |
  Fly     7 CLQWTSVVFSTLTLIVGVLAALAGVYELDKFNEGSAEHTEKFVQLGMAGALILAGLV-------G 64

  Fly    63 LAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVN--SEQQQQFAEQG-----WM--TVPTDL 118
            ..||:.....::...:|:|..|      |||....|:  :|.:|..|.:.     ||  .|....
  Fly    65 CLGAIFGSIKVMVVNLILLLAL------IASHIWKVSHYNETKQLDATEVYVMDLWMKELVHHGA 123

  Fly   119 RKQVQDSLKCCGFNATAPSTT--SVVPPSNEPSCELINQQCCAHSSEPDCRCEPCGPLLEDKIDY 181
            .:.:|...:|||....:..|:  ..||.|            |.|:.:......|.|......:..
  Fly   124 MQDLQQEYECCGDKGFSDYTSLNMKVPRS------------CFHTKDGIHALYPYGEGCMAAVKR 176

  Fly   182 AFKL---------CGGLGIFFSFTEVLAVFL-----------ARRY 207
            |:..         ||.:|.     ||:.:.|           .|||
  Fly   177 AYLQIYRYEKWVHCGLIGY-----EVVGIILGITLCCQLTNKTRRY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 46/236 (19%)
tetraspanin_LEL <121..177 CDD:243179 12/57 (21%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 46/232 (20%)
tetraspanin_LEL 110..178 CDD:239401 15/79 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.