DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp42El

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:246 Identity:56/246 - (22%)
Similarity:95/246 - (38%) Gaps:87/246 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KNALIALNILYVMIGFLL-----IGVGVYARAASIVTNLPIVGGILACGVILICISMLGLAGAVK 68
            |.:|...|.|:.::|.|:     :|.|....|.:|        |||..|..::.||:.|..|||:
  Fly     9 KYSLFLFNALWAILGILVLIFGGLGWGAMPDAYAI--------GILILGGTILVISLFGCCGAVR 65

  Fly    69 HHQVMLFFY--MIILFMLFLIQFSIAS--------SCLAVNSEQQQQFAEQGWMTVPTDLRKQVQ 123
            ....||:.|  ::::.:|.::.|.|.:        :...|.::.:.:..:.|.|.:       :|
  Fly    66 ESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKYALQTVENQWELEQTKPGSMDI-------IQ 123

  Fly   124 DSLKCCG------------FNATAPSTTSVVPPSNEPSCELINQQCCAHSSEPDCRCEPC----- 171
            .:..|||            :|.|.||           ||               |:.:.|     
  Fly   124 KTYYCCGRDSAQDYLDIKFWNNTVPS-----------SC---------------CKDDSCVNPLN 162

  Fly   172 ----GPLLEDKIDYAFK--------LCGGLGIFFSFTEVLAVFLARRYRNQ 210
                |.|:  |::.||.        |..||..|.:...:||:.||..|.|:
  Fly   163 LYVRGCLI--KVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 52/238 (22%)
tetraspanin_LEL <121..177 CDD:243179 14/76 (18%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 50/229 (22%)
tetraspanin_LEL 94..178 CDD:239401 20/118 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.