DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:179 Identity:42/179 - (23%)
Similarity:67/179 - (37%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GVILICISMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQG----WM 112
            |.:::..|:.|.....|..:|:|..|.::|..|.::|..:.|...|.:.:.......||    | 
  Fly    61 GTVIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLW- 124

  Fly   113 TVPTDLRKQ-------VQDSLKCCGFNATAPST-TSVVPPSNEPSCELINQQCCAHSSEPDCRCE 169
                ||:.:       .::.|.|||.|:..... ...:||   ||| .:|:.|..|.:.....||
  Fly   125 ----DLQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMPP---PSC-CLNRDCTKHLNLFMTGCE 181

  Fly   170 PCGPLLEDKIDYAFKLCGG--LGIFFSFTEVLAVFLARRYRNQHDPCYL 216
                       ..||...|  ...|.|.:..|.:|   .:......|||
  Fly   182 -----------VKFKEYVGAKTANFHSLSWFLVIF---EFAGSVTTCYL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 39/165 (24%)
tetraspanin_LEL <121..177 CDD:243179 15/63 (24%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 42/179 (23%)
tetraspanin_LEL 109..192 CDD:239401 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442881
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.