DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp39D

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:101/237 - (42%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GGFTCSKNALIALNILYVMIGFLLIGVG-----VYARAASIVTN----LPIVGGILACGVILICI 58
            ||.||.|......|:|:.:.|.|:..||     .||..::.|::    .||:..|:...|.:|| 
  Fly     4 GGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVIC- 67

  Fly    59 SMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMTVP-----TDL 118
             .||..||:|....|:..:.::..::||.:..:..:....::...|....|...|:.     .|.
  Fly    68 -FLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADY 131

  Fly   119 RKQ---VQDSLKCCGFNATAPSTT----SVVPPSNEPSCELIN----QQCC-AHSSEPDCRCEPC 171
            |..   :|..|.|||.|......|    |.:|.:   .|.:||    ::|. .|:::..| .:..
  Fly   132 RDAWTLLQTELDCCGINGPNDWETVYRNSTLPAA---CCSVINLSEAKECTNTHATQHGC-LQKL 192

  Fly   172 GPLLEDK-IDYAFKLCGGLGIFFSFTEVLAVFLARRYRNQHD 212
            ..:|:.| :..|..:.|..||.. .|.:.|..|.|.:|..:|
  Fly   193 LEILDSKTLILASVVLGVAGIQM-LTILFACCLYRSFRRSYD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 53/223 (24%)
tetraspanin_LEL <121..177 CDD:243179 16/67 (24%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 54/225 (24%)
tetraspanin_LEL 104..200 CDD:239401 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.