DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp33B

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:105 Identity:22/105 - (20%)
Similarity:31/105 - (29%) Gaps:24/105 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMTVPTDLRKQVQDSLKCCGFNATAPSTTS 140
            ||:::...:..::|.|...|                ||.....|:...|.....|..........
  Fly   237 FYILMALWVLALKFLIVLCC----------------MTKFIVHRQNEGDGCDNVGLTDDDGHPLV 285

  Fly   141 VVPPSNEPSCELINQQCCAHSSEPD---CRC-----EPCG 172
            ||.......|..|.:......:.||   |.|     ||||
  Fly   286 VVKYPCNVRCVTIAEDDLVSDNVPDINYCNCTEMDDEPCG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 22/105 (21%)
tetraspanin_LEL <121..177 CDD:243179 14/60 (23%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 4/18 (22%)
CD151_like_LEL 112..237 CDD:239408 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442889
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.