DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:213 Identity:50/213 - (23%)
Similarity:81/213 - (38%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GFTCSKNALIALNILYVMIGFLLIGVGVYARAASIVTNLPIVGG----------------ILACG 52
            |..|:|..||.::.::.:...|||.||         |.:..:.|                ::|.|
  Fly    11 GMKCAKYMLIIVSFMFALTAILLIMVG---------TTIQTIFGDFSLFIDGHFSSPPALLIAIG 66

  Fly    53 VILICISMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSE---------------- 101
            .|||.::.||..||||...:::..|.:.||::|:::.|.|.:...:.|:                
  Fly    67 FILIAVAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALAEY 131

  Fly   102 QQQQFAEQGWMTVPTDLRKQVQDSLKCCGFNA--------------TAPSTTSVVPPS---NEP- 148
            :...:.|.|     .|.   :|..|:|||.|.              |......|||.|   |:| 
  Fly   132 EHDPYVESG-----VDF---MQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPT 188

  Fly   149 SCELINQQCCAHSSEPDC 166
            |.....|..|..:.:..|
  Fly   189 SLNDSTQMTCMETYDYGC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 49/210 (23%)
tetraspanin_LEL <121..177 CDD:243179 17/64 (27%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 49/210 (23%)
tetraspanin_LEL 110..218 CDD:239401 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.