DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp5D

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:271 Identity:54/271 - (19%)
Similarity:98/271 - (36%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GFTCSKNALIALNILYVMIGFLLIGVGVYARA--ASIVTNLPIVGGILACGVIL------ICISM 60
            |:||.:.....|||:..:.....:|.|::.|.  |...|.||...|:.|..:.:      ..:|.
  Fly     5 GYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSF 69

  Fly    61 LGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSC--------------LAVNSEQQQQFAEQGW 111
            .|..||....:.:|..|.:::.|||:.:|.:.|..              |....|:....:::|.
  Fly    70 FGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGS 134

  Fly   112 MTVPT--DLRKQVQDSLKCCGFNATAPSTTSVVPPSNEPSCELINQQCCA--------------- 159
            :..|:  .:...||.|.:|||.:    |........:.|....:.:.||.               
  Fly   135 LVAPSVASIWDSVQQSFECCGVS----SYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGD 195

  Fly   160 HSSEPDC-RCE--------PCGPLLEDKIDYAFKLCGGLGIFFSFTEV------LAVFLARRYRN 209
            ....||| |.|        .|...|:........:.|.:|:..:|.::      :.:|...:::.
  Fly   196 GMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKR 260

  Fly   210 QHD--PCYLPA 218
            ..|  ..|.|:
  Fly   261 ASDTYKSYSPS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 49/250 (20%)
tetraspanin_LEL <121..177 CDD:243179 17/79 (22%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 49/251 (20%)
NET-5_like_LEL 105..228 CDD:239418 21/126 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.