DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and TSPAN13

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_055214.1 Gene:TSPAN13 / 27075 HGNCID:21643 Length:204 Species:Homo sapiens


Alignment Length:213 Identity:93/213 - (43%)
Similarity:131/213 - (61%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGGFTCSKNALIALNILYVMIGFLLIGVGVYARAASIVTNLPIVGGILACGVILICISMLGLAG 65
            :||||.||||.|.|||:||.::..||||:..:.....::::|.:||.::|.|:.|..|:::||.|
Human     2 VCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIG 66

  Fly    66 AVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMTVPTDLRKQVQDSLKCCG 130
            |||||||:||||||||.::|::|||::.:|||:|.|||.|..|.||... ...|..:|.:|.|||
Human    67 AVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNT-ASARNDIQRNLNCCG 130

  Fly   131 FNATAPSTTSVVPPSNEPSCELINQQCCAHSSEPDCRCEPCGPLLEDKIDYAFKLCGGLGIFFSF 195
            |.:..|                 |..|.|...:.|..|.||.|::.:......:..||:|:||||
Human   131 FRSVNP-----------------NDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSF 178

  Fly   196 TEVLAVFLARRYRNQHDP 213
            ||:|.|:|..|||||.||
Human   179 TEILGVWLTYRYRNQKDP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 81/196 (41%)
tetraspanin_LEL <121..177 CDD:243179 15/55 (27%)
TSPAN13NP_055214.1 Tetraspannin <55..187 CDD:366035 62/149 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 168 1.000 Domainoid score I3837
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8671
Inparanoid 1 1.050 199 1.000 Inparanoid score I3796
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52462
OrthoDB 1 1.010 - - D1203231at2759
OrthoFinder 1 1.000 - - FOG0003591
OrthoInspector 1 1.000 - - otm42235
orthoMCL 1 0.900 - - OOG6_105658
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5169
SonicParanoid 1 1.000 - - X2941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.