DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp68C

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:267 Identity:51/267 - (19%)
Similarity:97/267 - (36%) Gaps:73/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CSKNALIALNI---LYVMIGFLLIGVGVY--------------ARAASIVTNLP------IVGGI 48
            |..|....||:   |:::.|.||:..|:|              |.::..:::||      |..|:
  Fly     3 CCFNYKFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIALGV 67

  Fly    49 LACGVILICISMLGLAGAVKHHQVMLFFYMIILFMLFL------IQFSIASSCLAVNSEQQQQFA 107
            ...|.:....:::|...:..|....|..|.:.:.:|.|      :..::...||.::.::.|...
  Fly    68 AIAGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVR 132

  Fly   108 E-QGWMTVP-----TDLRKQVQDSLKCCGFNATAPSTTSV------------VP----------- 143
            . |....||     |:.....|....|||..::....||:            ||           
  Fly   133 SLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGH 197

  Fly   144 --------PSNEPSCELINQQCCAHSSEPDCRCEPCGPLLEDKIDYAFKLCGGLGIFFSFTE--- 197
                    |:||..|:.:.:.    |.|.:...|.|.|.|::.....:.:..|..:..:..|   
  Fly   198 SMAYLDPKPANESMCQSLERL----SYERERHTESCLPHLDNWYREQYSIFLGASLILAMIEFCV 258

  Fly   198 VLAVFLA 204
            :||:.::
  Fly   259 LLAIIMS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 51/265 (19%)
tetraspanin_LEL <121..177 CDD:243179 18/86 (21%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 49/262 (19%)
tetraspanin_LEL 117..241 CDD:239401 25/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.