DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6330 and Upp2

DIOPT Version :9

Sequence 1:NP_733175.1 Gene:CG6330 / 43240 FlyBaseID:FBgn0039464 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_011237507.1 Gene:Upp2 / 76654 MGIID:1923904 Length:416 Species:Mus musculus


Alignment Length:297 Identity:136/297 - (45%)
Similarity:187/297 - (62%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KAHYDC-----------------AHRSSLQDDETDDAYVKRITRYSDGTVKLRNSNIELMDQDIL 61
            :.|.||                 ::||...|..|.:.  ||       :|.::|..:|.||:|||
Mouse   114 ETHPDCGWPLLAAVQSMASILPASNRSMRPDKNTYER--KR-------SVYVKNPYLEGMDEDIL 169

  Fly    62 YHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYKLPA-GTQLQDISAYSYRYSM 125
            |||.||:::|:|..|||||||||:||:|.||:.||.|:..|:  :|.. |..::||.|.:.||.|
Mouse   170 YHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFAQFMHKEL--RLEGDGEDIEDICAGTDRYCM 232

  Fly   126 YKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDPVFIRIGTCGGIGVDGGTVIITEDALDGQ 190
            :|.||||.||||||.||:||::||:|||::||.|.|...|||||.||||:..|:|:||:.|:|..
Mouse   233 FKTGPVLSVSHGMGIPSISIMLHELIKLLHHAHCCDVTIIRIGTSGGIGIAPGSVVITDTAVDSF 297

  Fly   191 LRNSHEFTILGKTIHRPAKLDKKLARELKSLASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDF 255
            .:...|..||...:.|..:|||:||.:|.:.:.......|:||.|:||.||||||||||||.|.|
Mouse   298 FKPRFEQVILDNVVTRSTELDKELANDLFNCSREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSF 362

  Fly   256 SENEKMAYLEKLRENGVVNIEMESTIFAALTHHAGIK 292
            |..:|:.||::....||.|||||||:|||:....|::
Mouse   363 SREKKLDYLKRAYRAGVRNIEMESTVFAAMCGLCGLR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6330NP_733175.1 PNP_UDP_1 50..337 CDD:294213 126/244 (52%)
Upp2XP_011237507.1 UP_hUPP-like 166..399 CDD:350163 122/234 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 254 1.000 Domainoid score I2048
eggNOG 1 0.900 - - E1_COG2820
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12654
Inparanoid 1 1.050 301 1.000 Inparanoid score I2663
Isobase 1 0.950 - 0 Normalized mean entropy S3783
OMA 1 1.010 - - QHG59199
OrthoDB 1 1.010 - - D1423938at2759
OrthoFinder 1 1.000 - - FOG0002165
OrthoInspector 1 1.000 - - mtm8805
orthoMCL 1 0.900 - - OOG6_101919
Panther 1 1.100 - - LDO PTHR43691
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3955
SonicParanoid 1 1.000 - - X2157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.