DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6330 and CG17224

DIOPT Version :9

Sequence 1:NP_733175.1 Gene:CG6330 / 43240 FlyBaseID:FBgn0039464 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001162855.1 Gene:CG17224 / 33510 FlyBaseID:FBgn0031489 Length:300 Species:Drosophila melanogaster


Alignment Length:304 Identity:135/304 - (44%)
Similarity:203/304 - (66%) Gaps:17/304 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SDGTVKLRNSNIELMDQDILYHLALG----SESHDLQEMFGDVKFVCMGGTPKRMENFAHF---- 98
            ||.||:|.|.::|....|.||||.:.    .::.:||..||||:.:|||||..||...|.:    
  Fly     2 SDKTVELMNPHLETARSDYLYHLDINVANTRDTSELQNRFGDVRVICMGGTGSRMRQLALYLRDI 66

  Fly    99 -IMNEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDP 162
             :::|.|..:       |:.....||:|||||||||||||:|:.|.|:::||:|||:.:|:|:||
  Fly    67 LVVSESGDPV-------DLCERGNRYAMYKVGPVLCVSHGVGSSSFSVVLHELIKLLKYARCQDP 124

  Fly   163 VFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLARELKSL-ASPDD 226
            |.:|||||||:||..|||:.:::|.:|.|||.||..|||:.:.|||:..:.:.|:|.:. ...:|
  Fly   125 VLLRIGTCGGLGVPPGTVVASKNAFNGLLRNEHEIAILGQRVVRPAQFSEDVIRDLLAFGVDAND 189

  Fly   227 PYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKLRENGVVNIEMESTIFAALTHHAGI 291
            .:.||...|:.|:.|||||||.|||.|::||.:||.:|:|..:.|:.|||||:::||::|...|:
  Fly   190 GFQTISANTMGTDCFYEGQGRTDGAICEYSEKDKMEFLQKCHDLGIRNIEMEASMFASVTQKVGV 254

  Fly   292 KAAVVCVALLNRLNGDQVNAPKEVMNEWQARPQILVSRYIRKVL 335
            ||..|||.|::||.|||:....:..:|::.||..:|.|||:::|
  Fly   255 KAGDVCVTLIDRLKGDQITITIDQKHEFEQRPFFVVGRYIKRLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6330NP_733175.1 PNP_UDP_1 50..337 CDD:294213 130/296 (44%)
CG17224NP_001162855.1 euk_UDPppase 10..300 CDD:130780 130/296 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455527
Domainoid 1 1.000 57 1.000 Domainoid score I611
eggNOG 1 0.900 - - E1_COG2820
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I429
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423938at2759
OrthoFinder 1 1.000 - - FOG0002165
OrthoInspector 1 1.000 - - otm14813
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43691
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.