DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6330 and CG12065

DIOPT Version :10

Sequence 1:NP_733175.1 Gene:CG6330 / 43240 FlyBaseID:FBgn0039464 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster


Alignment Length:290 Identity:65/290 - (22%)
Similarity:94/290 - (32%) Gaps:95/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTITDNQTHD---FKAHYDC---AHRSSLQDDETDDAYVKRITRYSDG--TVKLRNSNIELMDQD 59
            |||..|:...   ..|.| |   |..:.|::.||   :|:..|..||.  |..||.|.       
  Fly   366 PTIASNKQPTIAIITAQY-CEKLAVDAMLENKET---FVRYTTVDSDPNLTNSLRKSK------- 419

  Fly    60 ILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYKLPAGTQLQDISAYSYRYS 124
                         .:..||:.....:|...      ||.|   :..|||        |..|.|.:
  Fly   420 -------------KKRRFGESNVYTLGNIG------AHRI---VSTKLP--------SVGSNREA 454

  Fly   125 MYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDPVFIRIGTCGGIG--VD-------GGTV 180
            |...|                  :...:|:...:..|.||| :|..||:.  .|       |..|
  Fly   455 MTATG------------------NTTTRLLGTFQKVDYVFI-VGVAGGVPHYTDYKKHVRLGDVV 500

  Fly   181 IITEDALDGQLRNSHE--FTIL---GKTIHRPAKLDKKLARELKSLAS------PDDPY-----D 229
            |...|.....:.||.|  :..|   |:.:.....::..|.:..:||.:      |.:.|     .
  Fly   501 ISYVDKQRALISNSKEKPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRPWEDYLNQAQQ 565

  Fly   230 TIIGKTLCTNDFYEGQGRLDGAFCDFSENE 259
            .:..||  ..||.....|.|..|.:...||
  Fly   566 ALAQKT--DADFNRPDARTDKLFMNIGNNE 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6330NP_733175.1 UP_hUPP-like 59..333 CDD:350163 46/226 (20%)
CG12065NP_001368976.1 COG2512 290..>342 CDD:442002
MtnN 375..697 CDD:440538 61/281 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.