DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6330 and CG12065

DIOPT Version :9

Sequence 1:NP_733175.1 Gene:CG6330 / 43240 FlyBaseID:FBgn0039464 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster


Alignment Length:290 Identity:65/290 - (22%)
Similarity:94/290 - (32%) Gaps:95/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTITDNQTHD---FKAHYDC---AHRSSLQDDETDDAYVKRITRYSDG--TVKLRNSNIELMDQD 59
            |||..|:...   ..|.| |   |..:.|::.||   :|:..|..||.  |..||.|.       
  Fly   366 PTIASNKQPTIAIITAQY-CEKLAVDAMLENKET---FVRYTTVDSDPNLTNSLRKSK------- 419

  Fly    60 ILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYKLPAGTQLQDISAYSYRYS 124
                         .:..||:.....:|...      ||.|   :..|||        |..|.|.:
  Fly   420 -------------KKRRFGESNVYTLGNIG------AHRI---VSTKLP--------SVGSNREA 454

  Fly   125 MYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDPVFIRIGTCGGIG--VD-------GGTV 180
            |...|                  :...:|:...:..|.||| :|..||:.  .|       |..|
  Fly   455 MTATG------------------NTTTRLLGTFQKVDYVFI-VGVAGGVPHYTDYKKHVRLGDVV 500

  Fly   181 IITEDALDGQLRNSHE--FTIL---GKTIHRPAKLDKKLARELKSLAS------PDDPY-----D 229
            |...|.....:.||.|  :..|   |:.:.....::..|.:..:||.:      |.:.|     .
  Fly   501 ISYVDKQRALISNSKEKPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRPWEDYLNQAQQ 565

  Fly   230 TIIGKTLCTNDFYEGQGRLDGAFCDFSENE 259
            .:..||  ..||.....|.|..|.:...||
  Fly   566 ALAQKT--DADFNRPDARTDKLFMNIGNNE 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6330NP_733175.1 PNP_UDP_1 50..337 CDD:294213 47/235 (20%)
CG12065NP_001368976.1 NP-I 376..696 CDD:365790 61/280 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.