DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and CYC8

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_009670.3 Gene:CYC8 / 852410 SGDID:S000000316 Length:966 Species:Saccharomyces cerevisiae


Alignment Length:496 Identity:93/496 - (18%)
Similarity:172/496 - (34%) Gaps:127/496 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VQILRSGEEGHYPDLQRCAEEKLKALKPDSK---------LFRYEEQIKQSTD-LD----KTELK 88
            |.::|:.....|...|       :|:..||:         :..|  ||.|..| ||    ...|.
Yeast   305 VHMIRTDYTAAYDAFQ-------QAVNRDSRNPIFWCSIGVLYY--QISQYRDALDAYTRAIRLN 360

  Fly    89 PILD--WTD---AIKTKDNALNE-LKKVKQ----NLNLPSVRK----LSKIDLEKESKTEKPKPA 139
            |.:.  |.|   ..:|.:|.|:: |...||    ::|...:|:    |:| .||......|...|
Yeast   361 PYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTK-QLENPGNINKSNGA 424

  Fly   140 PKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISNHSKSVTTDKLQS 204
            |...||:                     |...||:..|............||..|.:.|...:|.
Yeast   425 PTNASPA---------------------PPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQ 468

  Fly   205 ERD----------SLYE-----RLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNC 254
            :..          ::|.     :||||.:..:|.:.:..|:. :.:.....:|:....|..:...
Yeast   469 QHPAQQTPINSSATMYSNGASPQLQAQAQAQAQAQAQAQAQA-QAQAQAQAQAQAQAQAQAQAQA 532

  Fly   255 SIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLN 319
                           :|.||.:.:....|.:..||..|......:...:..:....:.:..:...
Yeast   533 ---------------QAQAHAQAQAQAQAQAQAQAQAQAQQQQQQQQQQQQQQQQQQQQQQQQQQ 582

  Fly   320 VYKKLLDFEPDNAIAKK--AVEKLTSMLGEVAPSSATRLIIEEIDP--------PQLKTSEPKKE 374
            ..::.|...|...:.:|  :|:.|....|:...:..|.:...::.|        ||.....|:::
Yeast   583 QQQQQLQPLPRQQLQQKGVSVQMLNPQQGQPYITQPTVIQAHQLQPFSTQAMEHPQSSQLPPQQQ 647

  Fly   375 AEKSEPTVVKKPEPV---VSAKKPPPIKDYDLAELVKPNRMVKS----NLVSAAEALGNKMQASK 432
            ..:|    |:.|:.:   ..|:.|.|:..:::.:.|.|.:....    .||.||.:.....: :.
Yeast   648 QLQS----VQHPQQLQGQPQAQAPQPLIQHNVEQNVLPQKRYMEGAIHTLVDAAVSSSTHTE-NN 707

  Fly   433 GGAPKKP------QSP--------PMTPKETLLRLPQDNLN 459
            ..:|::|      |:|        |...|:. |..|..|:|
Yeast   708 TKSPRQPTHAIPTQAPATGITNAEPQVKKQK-LNSPNSNIN 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 10/65 (15%)
TPR repeat 229..257 CDD:276809 3/27 (11%)
TPR repeat 262..293 CDD:276809 6/30 (20%)
TPR_11 266..329 CDD:290150 8/62 (13%)
TPR 266..297 CDD:197478 7/30 (23%)
TPR repeat 298..326 CDD:276809 0/27 (0%)
CYC8NP_009670.3 TPR <38..142 CDD:223533
TPR repeat 46..74 CDD:276809
TPR repeat 80..108 CDD:276809
TPR 94..391 CDD:223533 23/94 (24%)
TPR repeat 113..143 CDD:276809
TPR repeat 150..178 CDD:276809
TPR repeat 184..211 CDD:276809
TPR repeat 223..253 CDD:276809
TPR repeat 258..290 CDD:276809
TPR repeat 296..324 CDD:276809 5/25 (20%)
TPR repeat 329..359 CDD:276809 7/31 (23%)
TPR repeat 364..393 CDD:276809 8/28 (29%)
Herpes_BLLF1 <697..944 CDD:282904 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.