DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and SWA2

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_010606.1 Gene:SWA2 / 851918 SGDID:S000002728 Length:668 Species:Saccharomyces cerevisiae


Alignment Length:481 Identity:100/481 - (20%)
Similarity:168/481 - (34%) Gaps:140/481 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VEKCTNARE----MEKIVQILRSGEEGHYPDLQRCAEEKLKALK---------PDSKLFRYEEQI 76
            :|:.|...|    .|:.::||:|.::.......|..|..:|..|         ..:.||      
Yeast   157 IEEATEFYENDVTYERYLEILKSKQKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLF------ 215

  Fly    77 KQSTDLDKTELKPILDWTDAIKTKDNALNELKKVK---QNLNLPSVR-KLSKIDLEKESKTEKPK 137
            ..:||......|.:..||......::.||...|..   ::.:||.|. ..::|..|.....|...
Yeast   216 SMATDFFNKGKKLVDQWTSFPPEANDRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLP 280

  Fly   138 PAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISNHSKSVTTDKL 202
            ||.                          :||:::| .|...:.|..:|.....:||.|.|:..|
Yeast   281 PAD--------------------------NPDQDLL-TDFETKIDITKRTAPDVSHSSSPTSGIL 318

  Fly   203 QSE---------RDSLYERLQAQLKN---------------------LSQLEKEQFAERHRLRGN 237
            ..|         .|||.:..:..|.|                     :|.:|...:.| .:.:|.
Yeast   319 IEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTIPISDIELSGYNE-FKAKGT 382

  Fly   238 ESFKAKEYENAIEEYNCSIIYDPEN---AVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMN-- 297
            ..||..:|.|:::||..|:...|.|   .:.|.:|...:.||:.:|..:|.:....|::.|.:  
Yeast   383 SLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKA 447

  Fly   298 -------------------IKAHLRMAEAHNAEGKHLES----LNVYKKLL--DFEPDNAIAKKA 337
                               .|..:|.||:.    :||||    |..|::|:  :|..|..:..| 
Yeast   448 KWKNKISNSDPERSFNDIWPKIMIRRAESF----EHLESFKKALETYQELIKKNFFDDKIMQGK- 507

  Fly   338 VEKLTSMLGEVAPSSATRLIIEEIDPPQLKTSEPKKEAEKSEPTVVKKPEPVVSAKKPPPIKDYD 402
                             |...:.|:||.:|.|.|.|:...:.....||.....|:...|...|  
Yeast   508 -----------------RRCQDFINPPPVKKSMPVKKKTTTTSPATKKQNLTASSSNSPISVD-- 553

  Fly   403 LAELVKPNRMVKSNLVSAAEALGNKM 428
                 ..:.:.|..|.:|..||.:|:
Yeast   554 -----STSEIKKRELENAKLALYDKV 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 18/68 (26%)
TPR repeat 229..257 CDD:276809 9/27 (33%)
TPR repeat 262..293 CDD:276809 8/33 (24%)
TPR_11 266..329 CDD:290150 20/89 (22%)
TPR 266..297 CDD:197478 8/30 (27%)
TPR repeat 298..326 CDD:276809 11/33 (33%)
SWA2NP_010606.1 Ubiq-assoc 138..181 CDD:401184 7/23 (30%)
TPR <374..497 CDD:223533 30/127 (24%)
TPR repeat 374..402 CDD:276809 9/28 (32%)
TPR repeat 407..441 CDD:276809 8/33 (24%)
TPR repeat 467..495 CDD:276809 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.