DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and TAH1

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_009986.1 Gene:TAH1 / 850424 SGDID:S000000656 Length:111 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:32/99 - (32%)
Similarity:47/99 - (47%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAI 284
            :||.||:      :.:||..||...|..|:..|:..|...|:|.| .|:|:|:|.:||.:|..||
Yeast     1 MSQFEKQ------KEQGNSLFKQGLYREAVHCYDQLITAQPQNPV-GYSNKAMALIKLGEYTQAI 58

  Fly   285 SDCQACLQID------PMNIKAHLRMAEAHNAEG 312
            ..||..|:..      .:..|...|:..|..|.|
Yeast    59 QMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVG 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 23/71 (32%)
TPR repeat 229..257 CDD:276809 7/27 (26%)
TPR repeat 262..293 CDD:276809 14/30 (47%)
TPR_11 266..329 CDD:290150 17/53 (32%)
TPR 266..297 CDD:197478 12/36 (33%)
TPR repeat 298..326 CDD:276809 5/15 (33%)
TAH1NP_009986.1 TPR repeat 8..32 CDD:276809 7/23 (30%)
C39_PA2778_fam <11..68 CDD:411481 23/57 (40%)
TPR repeat 37..67 CDD:276809 14/30 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.