DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and TMTC4

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001337500.1 Gene:TMTC4 / 84899 HGNCID:25904 Length:818 Species:Homo sapiens


Alignment Length:240 Identity:46/240 - (19%)
Similarity:84/240 - (35%) Gaps:78/240 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 HLKLKKYFSAI--------------------SDCQ---ACLQIDPMNIKAHLRMAEAHNAEGKHL 315
            |.|.||..:|:                    |:.|   :.|.:.|:|.|.|..:.:....:|...
Human   512 HTKKKKLIAAVVLGILFINTLRCVLRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQT 576

  Fly   316 ESLNVYKKLLDFEP---------DNAIAKK----AVEKLTSMLGEVAPSSATRLIIEEIDPPQLK 367
            .::..|::.:...|         .|.:.::    ..|:|.|:..::.|..|...:...|....||
Human   577 AAIRYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLK 641

  Fly   368 TSEPKKEAEKSEPTVVKKPEPVVSAKKPPPIKDYDL-------------------AELVKP-NRM 412
            ..|   .||:|..|.:|.       ::..|...|:|                   |.::|| :.:
Human   642 RFE---AAEQSYRTAIKH-------RRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSL 696

  Fly   413 VKSNLVSAAEALGNKMQASKGGAPKKPQSPPMTPKETLLRLPQDN 457
            ..:|::...:..||..||...|            :|.|..:|.|:
Human   697 AWNNMIILLDNTGNLAQAEAVG------------REALELIPNDH 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 8/43 (19%)
TPR repeat 229..257 CDD:276809
TPR repeat 262..293 CDD:276809 8/41 (20%)
TPR_11 266..329 CDD:290150 14/77 (18%)
TPR 266..297 CDD:197478 9/45 (20%)
TPR repeat 298..326 CDD:276809 4/27 (15%)
TMTC4NP_001337500.1 DUF1736 369..443 CDD:369859
TPR 558..794 CDD:223533 37/194 (19%)
TPR repeat 559..587 CDD:276809 4/27 (15%)
TPR repeat 592..622 CDD:276809 4/29 (14%)
TPR repeat 627..655 CDD:276809 9/30 (30%)
TPR repeat 661..687 CDD:276809 3/25 (12%)
TPR repeat 695..723 CDD:276809 7/39 (18%)
TPR repeat 728..758 CDD:276809 1/2 (50%)
TPR repeat 763..791 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.