DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Phox1

DIOPT Version :10

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_180101.4 Gene:Phox1 / 817067 AraportID:AT2G25290 Length:745 Species:Arabidopsis thaliana


Alignment Length:205 Identity:53/205 - (25%)
Similarity:89/205 - (43%) Gaps:35/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 GNESFKAKEYENAIEEYNCSIIYDPENAVH---AYNNRAVA----HLKLKKYFSAISDCQACLQI 293
            ||:.|:.::||.|:..|:.::...|.:  |   ||...::|    .:.|.:|.:||::|...|:.
plant    59 GNKLFQKRDYEGAMFRYDKAVKLLPRD--HGDVAYLRTSMASCYMQMGLGEYPNAINECNLALEA 121

  Fly   294 DPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSML-GE---------- 347
            .|...||.|:.|..:.|..|...:....:.:|:.||:|..|.:..|::..:| |:          
plant   122 SPRFSKALLKRARCYEALNKLDFAFRDSRVVLNMEPENVSANEIFERVKKVLVGKGIDVDEMEKN 186

  Fly   348 ---VAPSSATRL--IIEEIDPPQLKTS----------EPKKEAEKSEPTVVKKPEPVVSAKKPPP 397
               |.|..|.||  |::|....:.|.|          |.|......|...|...|.|.|.:|...
plant   187 LVNVQPVGAARLRKIVKERLRKKKKKSMTMTNGGNDGERKSVEAVVEDAKVDNGEEVDSGRKGKA 251

  Fly   398 IKDYDLAELV 407
            |::..|.:.|
plant   252 IEEKKLEDKV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 NlpI <229..373 CDD:443815 43/169 (25%)
TPR repeat 229..257 CDD:276809 7/20 (35%)
TPR repeat 262..293 CDD:276809 10/37 (27%)
TPR repeat 298..326 CDD:276809 6/27 (22%)
Phox1NP_180101.4 TPR repeat 52..80 CDD:276809 7/20 (35%)
TPR 59..>162 CDD:440225 29/104 (28%)
TPR repeat 85..121 CDD:276809 10/37 (27%)
PB1 280..356 CDD:214770
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.