DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Ttc32

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_083597.1 Gene:Ttc32 / 75516 MGIID:1922766 Length:148 Species:Mus musculus


Alignment Length:172 Identity:41/172 - (23%)
Similarity:59/172 - (34%) Gaps:62/172 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 GNES----------FKAKEYENAIEEYN------------CSIIYDPENAVHAYNNRAVAHLKLK 278
            |.||          |...|:..|.|.|:            ||    ||:...|||||...     
Mouse     9 GGESSAALATAQARFSRGEFAEARELYSAFIGQCARHGSKCS----PEDLATAYNNRGQT----- 64

  Fly   279 KYFS-----AISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEP--DNAIAKK 336
            ||||     |:.|..:.::|.|.....:..........|...|:|..:||.||..|  .:|:.  
Mouse    65 KYFSVDFYEAMDDYTSAIEILPSFEVPYYNRGLIRYRLGYFDEALEDFKKALDLNPGFQDAVL-- 127

  Fly   337 AVEKLTSMLGEVAPSSATRLIIEEIDPPQLKTSEPKKEAEKS 378
                           |..:.|::       |..:.::.||||
Mouse   128 ---------------SLKQTILD-------KEEKQRRNAEKS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 24/85 (28%)
TPR repeat 229..257 CDD:276809 10/42 (24%)
TPR repeat 262..293 CDD:276809 11/35 (31%)
TPR_11 266..329 CDD:290150 20/67 (30%)
TPR 266..297 CDD:197478 13/35 (37%)
TPR repeat 298..326 CDD:276809 5/27 (19%)
Ttc32NP_083597.1 TPR_11 11..86 CDD:290150 23/83 (28%)
TPR 1 12..45 6/32 (19%)
TPR_11 55..120 CDD:290150 20/69 (29%)
TPR 2 55..88 13/37 (35%)
TPR repeat 55..83 CDD:276809 11/32 (34%)
TPR repeat 88..118 CDD:276809 6/29 (21%)
TPR 3 89..122 8/32 (25%)
TPR_1 92..122 CDD:278916 8/29 (28%)
TPR repeat 123..148 CDD:276809 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.