DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Lonrf3

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006541467.1 Gene:Lonrf3 / 74365 MGIID:1921615 Length:805 Species:Mus musculus


Alignment Length:230 Identity:51/230 - (22%)
Similarity:89/230 - (38%) Gaps:64/230 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 AERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQI 293
            |.:.|..||..|:..:.|.|:.:||.::...|.:.: .|:||:..:..|:.:..|:.|.:...::
Mouse   244 ASQLRHEGNRLFREHQVEAALLKYNEAVRLAPNDHL-LYSNRSQIYFTLESHEDALHDAEIACKL 307

  Fly   294 DPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRLII 358
            .||..|||.|.|:|....||..|:|..:...:..:..|..|:               |.|.||:.
Mouse   308 RPMGFKAHFRKAQALATLGKVKEALKEFLYCVSLDGKNKSAR---------------SEAQRLLF 357

  Fly   359 EEIDPPQLKTSEPKKEAEKSEPTVVKKPEPVVSAKKPPPIKDYDLAELVKPNRMVKSNLVSAAEA 423
            ....|     |.|.:..|.|.                      |:.:|:.|:..:|.::.|    
Mouse   358 SFFSP-----SVPGESQEHSP----------------------DILKLLAPHPRLKEHVES---- 391

  Fly   424 LGNKMQASKGGAPKKPQSPPMTPKETLLRLPQDNL 458
                 .|::|.:...|            :|.|:||
Mouse   392 -----MATEGTSHNLP------------KLSQENL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 16/65 (25%)
TPR repeat 229..257 CDD:276809 9/27 (33%)
TPR repeat 262..293 CDD:276809 6/30 (20%)
TPR_11 266..329 CDD:290150 18/62 (29%)
TPR 266..297 CDD:197478 7/30 (23%)
TPR repeat 298..326 CDD:276809 10/27 (37%)
Lonrf3XP_006541467.1 RING1-HC_LONFs 159..197 CDD:319427
3a0801s09 <244..>359 CDD:273380 34/130 (26%)
TPR repeat 244..272 CDD:276809 9/27 (33%)
TPR repeat 277..307 CDD:276809 6/30 (20%)
TPR repeat 312..335 CDD:276809 10/22 (45%)
PEX10 <456..551 CDD:227861
RING2-HC_LONFs 510..551 CDD:319428
LON_substr_bdg 601..802 CDD:366967
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.