DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and KDM6A

DIOPT Version :10

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001406738.1 Gene:KDM6A / 7403 HGNCID:12637 Length:1489 Species:Homo sapiens


Alignment Length:44 Identity:10/44 - (22%)
Similarity:23/44 - (52%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 FQLAHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVS 176
            |::...:|.|..|.:..:.:.:..:.|..:|||.:.::...:||
Human    71 FEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 NlpI <229..373 CDD:443815
TPR repeat 229..257 CDD:276809
TPR repeat 262..293 CDD:276809
TPR repeat 298..326 CDD:276809
KDM6ANP_001406738.1 TPR repeat 93..121 CDD:276809 6/22 (27%)
BepA 98..233 CDD:443813 5/17 (29%)
TPR repeat 129..159 CDD:276809
TPR repeat 164..194 CDD:276809
LapB 171..443 CDD:442196
TPR repeat 205..233 CDD:276809
TPR repeat 243..278 CDD:276809
TPR repeat 285..312 CDD:276809
TPR repeat 317..347 CDD:276809
TPR repeat 352..378 CDD:276809
JmjC 1151..1215 CDD:214721
JmjC 1185..1293 CDD:396791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.