| Sequence 1: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001406738.1 | Gene: | KDM6A / 7403 | HGNCID: | 12637 | Length: | 1489 | Species: | Homo sapiens |
| Alignment Length: | 44 | Identity: | 10/44 - (22%) |
|---|---|---|---|
| Similarity: | 23/44 - (52%) | Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 133 FQLAHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVS 176 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Spag1 | NP_651514.1 | NlpI | <229..373 | CDD:443815 | |
| TPR repeat | 229..257 | CDD:276809 | |||
| TPR repeat | 262..293 | CDD:276809 | |||
| TPR repeat | 298..326 | CDD:276809 | |||
| KDM6A | NP_001406738.1 | TPR repeat | 93..121 | CDD:276809 | 6/22 (27%) |
| BepA | 98..233 | CDD:443813 | 5/17 (29%) | ||
| TPR repeat | 129..159 | CDD:276809 | |||
| TPR repeat | 164..194 | CDD:276809 | |||
| LapB | 171..443 | CDD:442196 | |||
| TPR repeat | 205..233 | CDD:276809 | |||
| TPR repeat | 243..278 | CDD:276809 | |||
| TPR repeat | 285..312 | CDD:276809 | |||
| TPR repeat | 317..347 | CDD:276809 | |||
| TPR repeat | 352..378 | CDD:276809 | |||
| JmjC | 1151..1215 | CDD:214721 | |||
| JmjC | 1185..1293 | CDD:396791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||