DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Ttc32

DIOPT Version :10

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001385619.1 Gene:Ttc32 / 684830 RGDID:1585566 Length:148 Species:Rattus norvegicus


Alignment Length:93 Identity:22/93 - (23%)
Similarity:40/93 - (43%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SERDSLYERLQAQ-LKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAY 267
            :|...||.....| ..:.|:...|..|..:..||...:.:.::..|:::|..:|...|...| .|
  Rat    29 TEARELYSAFIGQCASHRSKCSPEDLATAYNNRGQTKYFSVDFYEAMDDYTSAIEILPNFEV-PY 92

  Fly   268 NNRAVAHLKLKKYFSAISDCQACLQIDP 295
            .||.:...:|..:..|:.|.:..|..:|
  Rat    93 YNRGLIRYRLGYFDEAVEDFKKALDRNP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 NlpI <229..373 CDD:443815 16/67 (24%)
TPR repeat 229..257 CDD:276809 5/27 (19%)
TPR repeat 262..293 CDD:276809 8/30 (27%)
TPR repeat 298..326 CDD:276809
Ttc32NP_001385619.1 TPR repeat 14..48 CDD:276809 4/18 (22%)
NlpI <19..129 CDD:443815 22/93 (24%)
TPR repeat 53..84 CDD:276809 6/30 (20%)
TPR repeat 89..117 CDD:276809 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.