DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Ifit3b

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006527327.1 Gene:Ifit3b / 667370 MGIID:3698419 Length:428 Species:Mus musculus


Alignment Length:469 Identity:94/469 - (20%)
Similarity:165/469 - (35%) Gaps:171/469 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GHYPDLQRCAEEKLKALKPDSK------LFRYEEQIKQSTDLDKTELKPILDWTDAIKTKDNALN 105
            ||.........|.|:|:.|..|      |||   :...|:.::                 |...|
Mouse    21 GHRRSQCEVNRESLEAILPQLKCHFTWNLFR---EGSMSSHME-----------------DRVCN 65

  Fly   106 ELKKVKQNLNLPSVRKLSKID-------LEKESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKW 163
            :|:      :|.|..|.:..|       |:.|||..                .|...::.|.|| 
Mouse    66 QLE------HLNSEEKATMYDLLAYIKHLDGESKAA----------------LECLGQAEDLRK- 107

  Fly   164 DKYDPDEEILRMDLNEERDQEQREKIIS--NHSKSVTTDKLQSERDSLYERLQAQLKNLS----- 221
                          :|.:||.:..::::  |::.........||..:..::::...:..:     
Mouse   108 --------------SEHKDQAEIRRLVTWGNYAWIYYHMGRLSEAQAYVDKVRQVCQKFANPYSM 158

  Fly   222 ---QLEKEQFAERHRLRGNESFKAKE-YENAIEEYNCSIIYDPENAVHAYNNRAVAHLKL----K 278
               :||.|:...|.:...||  :||. :|.|:||..    .|||    ..:..|:|..:|    :
Mouse   159 ECPELECEEGWTRLKCGRNE--RAKMCFEKALEEKP----KDPE----CSSGMAIAMFRLEEKPE 213

  Fly   279 KYFSAISDCQACLQIDPMN--IKA-----HLRMAEAHNAEGKHL---------ESLNVYKKLLDF 327
            |.|| :...:..::::|.|  :|.     .|||.|  .|||:.|         ...:|.:|...|
Mouse   214 KQFS-VDALKQAMELNPQNQYVKVLLALKLLRMGE--EAEGERLIKDALGKAPNQTDVLQKAAQF 275

  Fly   328 EPDNAIAKKAVEKLTSMLGEVAPSSAT--------RLIIEEIDPPQLKTSEPKKEAEKSE----- 379
            ........:|:|.|...|.....:|..        |.|:|::        :.|.:|:.||     
Mouse   276 YKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQL--------QNKGDADSSERRQRM 332

  Fly   380 ------------PTVVKKPEP------------------VVSAKKPPPIKDYDLAE----LVKPN 410
                        .|:.::..|                  :|.:|:.|.:::.||.|    |.:.:
Mouse   333 AELRRLTMEFMQKTLQRRRSPLNSYSDLIDFPEVERCYQMVISKESPDVEEEDLYERYCNLQEYH 397

  Fly   411 RMVKSNLVSAAEAL 424
            |  ||..::|.|.|
Mouse   398 R--KSEDLAALECL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 18/70 (26%)
TPR repeat 229..257 CDD:276809 9/28 (32%)
TPR repeat 262..293 CDD:276809 6/34 (18%)
TPR_11 266..329 CDD:290150 20/82 (24%)
TPR 266..297 CDD:197478 7/34 (21%)
TPR repeat 298..326 CDD:276809 11/41 (27%)
Ifit3bXP_006527327.1 TPR repeat 76..104 CDD:276809 6/43 (14%)
PEP_TPR_lipo <81..>325 CDD:274350 59/295 (20%)
TPR repeat 109..148 CDD:276809 6/38 (16%)
TPR repeat 161..189 CDD:276809 10/29 (34%)
TPR repeat 194..227 CDD:276809 9/37 (24%)
TPR repeat 266..294 CDD:276809 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.