DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and FKBPL

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_071393.2 Gene:FKBPL / 63943 HGNCID:13949 Length:349 Species:Homo sapiens


Alignment Length:183 Identity:50/183 - (27%)
Similarity:71/183 - (38%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 EILRMDLNEERDQEQREKIISNHS---KSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAERH 232
            |::...|......|:.|..:..||   ..:|.......|||.         .|...|||..|...
Human   158 ELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSW---------ELETSEKEALAREE 213

  Fly   233 RLRGNESFKAKEYENAIEEYNCSIIY--------DPENAV-HAYNNRAVAHLKLKKYFSAISDCQ 288
            |.||.|.|:|...|.|...|..::..        .||..| ||  |.|...|.|.:...|...|.
Human   214 RARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHA--NLAACQLLLGQPQLAAQSCD 276

  Fly   289 ACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKL 341
            ..|:.:|.::||..|...|..|.|...::....||:|..:|.|..|::.:.|:
Human   277 RVLEREPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 22/74 (30%)
TPR repeat 229..257 CDD:276809 10/27 (37%)
TPR repeat 262..293 CDD:276809 10/31 (32%)
TPR_11 266..329 CDD:290150 18/62 (29%)
TPR 266..297 CDD:197478 9/30 (30%)
TPR repeat 298..326 CDD:276809 8/27 (30%)
FKBPLNP_071393.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..55
TPR_11 187..>348 CDD:330823 44/154 (29%)
TPR 1 210..243 10/32 (31%)
TPR repeat 210..238 CDD:276809 10/27 (37%)
TPR repeat 251..281 CDD:276809 10/31 (32%)
TPR 2 252..285 11/34 (32%)
TPR 3 286..319 10/32 (31%)
TPR repeat 286..314 CDD:276809 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.