DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Fkbpl

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_063926.1 Gene:Fkbpl / 56299 MGIID:1932127 Length:347 Species:Mus musculus


Alignment Length:337 Identity:70/337 - (20%)
Similarity:117/337 - (34%) Gaps:57/337 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NAREMEKIVQILRSGEEGHYPDLQRCAEEKLK-ALKPDSKLFRYEEQIKQSTDLDKTELKPILDW 93
            ||:::.......|....|..|       |.|| .::||.     ..||.::.:::    .|:..:
Mouse    23 NAQQILNTAIPFRQRSPGLLP-------EALKVGVRPDP-----ANQIVETQEIE----HPVAGF 71

  Fly    94 ---TDAIKTKDNALNELKKVKQNLNLPSVRKLSKIDLEKESKTEKPKPAPK-----------ATS 144
               :|..:...|.:.|..:.......|....:.||.:.... .:|||...|           :..
Mouse    72 EGDSDQFQVSTNEMAEHLQASDLWYCPDGSFVKKIIVPGHG-LDKPKLGSKCQVLALGFPFGSGM 135

  Fly   145 PSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISNHS---KSVTTDKLQSER 206
            |.........|.....:.|.      |::...|...|..|:.:..:...|   ..:..|...:.|
Mouse   136 PEGWTELTIGIGQWREKMWG------ELMEKCLESMRQGEEAKIHLPGSSAPLAKLRLDSFTNGR 194

  Fly   207 DSLYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIY-------DPENAV 264
            ||.         .:..:|||..|:....||.|.|:|...:.|...|..::..       .|....
Mouse   195 DSW---------EMEAMEKEALAKEEHRRGTELFRAGNPQGAARCYGRALRLLLTLPPPGPPERT 250

  Fly   265 HAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEP 329
            ..|.|.|...|.|.....|...|...|:.:|.::||..|...|..|.|...::...:||:|..:|
Mouse   251 TLYANLAACQLLLGHPQLAAQSCDRVLEREPGHLKALYRRGVARAALGDLEKATADFKKVLAVDP 315

  Fly   330 DNAIAKKAVEKL 341
            .|..||:.:.|:
Mouse   316 KNRAAKEELGKV 327

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 17/72 (24%)
TPR repeat 229..257 CDD:276809 8/27 (30%)
TPR repeat 262..293 CDD:276809 8/30 (27%)
TPR_11 266..329 CDD:290150 18/62 (29%)
TPR 266..297 CDD:197478 9/30 (30%)
TPR repeat 298..326 CDD:276809 8/27 (30%)