DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and TTC12

DIOPT Version :10

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001305462.1 Gene:TTC12 / 54970 HGNCID:23700 Length:711 Species:Homo sapiens


Alignment Length:92 Identity:25/92 - (27%)
Similarity:36/92 - (39%) Gaps:20/92 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 CLRFPGQLNAD-LRKLA------------VNMVPFPRLHFFMPGFAPLTAKG-SQQYRALTVPEL 289
            |||. |.||.| .||:.            |:.:....||..|..|...|:.. ..||.|:.:..:
Human     2 CLRI-GSLNVDEFRKVLMKTGLVLVVLGHVSFIAAAVLHGTMLRFVATTSDAVVLQYCAVDILSV 65

  Fly   290 TQQM--FDAKNMMTACDPRHGRYLTCA 314
            |..:  :...::..||....   ||||
Human    66 TSAIVRWTVFSLSVACALLS---LTCA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 NlpI <229..373 CDD:443815 25/92 (27%)
TPR repeat 229..257 CDD:276809 10/30 (33%)
TPR repeat 262..293 CDD:276809 9/31 (29%)
TPR repeat 298..326 CDD:276809 6/17 (35%)
TTC12NP_001305462.1 TPR 105..>212 CDD:440225
TPR 1 106..139
TPR repeat 106..134 CDD:276809
TPR repeat 139..175 CDD:276809
TPR 3 180..213
TPR repeat 180..208 CDD:276809
TPR repeat 217..242 CDD:276809
armadillo repeat 561..597 CDD:293788
armadillo repeat 603..637 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.