DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and unc-45

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster


Alignment Length:245 Identity:66/245 - (26%)
Similarity:109/245 - (44%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHA--YNNRAVAHLKLKK 279
            :.|....|:...|..::.:|||:|||..:|.|:|.|..:|....::...|  |.|||.|:|||.|
  Fly     1 MTNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGK 65

  Fly   280 YFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSM 344
            |.:|:.||...|:..|.:.||..|.|:|:.|..|..|:......|...:|.|...:..:::|   
  Fly    66 YENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRL--- 127

  Fly   345 LGEVAPSSATRLIIEEIDPPQLKTSEPKKEA-----EKSEPTVVKKPEP---VVSAKKPPP---- 397
                      .:::||......|||...|:.     :.:.|...::...   ||.||:...    
  Fly   128 ----------HVVVEERSARNAKTSTKVKQMMDLTFDLATPIDKRRAAANNLVVLAKEQTGAELL 182

  Fly   398 IKDYDLAELVKPNRMVKS-----NLVSAAEAL-GNKMQASKG-----GAP 436
            .||:.:|::....::.|.     |:|....|| .|.::.:||     |.|
  Fly   183 YKDHCIAKVASLTKVEKDQDIYVNMVHLVAALCENSVERTKGVLTELGVP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 27/67 (40%)
TPR repeat 229..257 CDD:276809 11/27 (41%)
TPR repeat 262..293 CDD:276809 15/32 (47%)
TPR_11 266..329 CDD:290150 25/64 (39%)
TPR 266..297 CDD:197478 16/32 (50%)
TPR repeat 298..326 CDD:276809 9/27 (33%)
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 27/68 (40%)
TPR repeat 16..41 CDD:276809 10/24 (42%)
TPR repeat 46..79 CDD:276809 15/32 (47%)
TPR_11 50..115 CDD:290150 25/64 (39%)
TPR 50..83 CDD:197478 16/32 (50%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.