DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and spag

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster


Alignment Length:474 Identity:100/474 - (21%)
Similarity:175/474 - (36%) Gaps:152/474 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LKPDSKLFRYEEQIKQSTDLDKTELKPILDWTDAIKTKDNALNELKKVKQNLNLPSVRKLSKIDL 127
            :....|.|..:.|::|:....:..:|.:..|...||.|:   .||:|                  
  Fly     1 MSAQEKAFELQRQVRQNAREYENSVKDLYSWEQDIKNKE---KELQK------------------ 44

  Fly   128 EKESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISN 192
                            ||.:..||:..::|                    :.:.|:.::|...|:
  Fly    45 ----------------SPLSAANKDLPVRS--------------------HVQTDKSRKESPSSS 73

  Fly   193 HSKSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSII 257
            .:.|.|     .::|...:.:..|.|..:.::.         |||...|..|||.||..|:.:|.
  Fly    74 AASSPT-----EKQDLPVDPVAQQYKKANDIKD---------RGNTYVKQGEYEKAIVAYSTAIA 124

  Fly   258 YDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYK 322
            ..|.:.:: :.|||:.:||.:.:...:.||:|.:.:|.:.:||:.|..:|:.:.|.::|:|....
  Fly   125 VYPHDPIY-HINRALCYLKQESFDQCVEDCEAAIALDKLCVKAYYRRMQANESLGNNMEALKDCT 188

  Fly   323 KLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRL------IIE--EIDPPQLKTSEPKKEAEKSE 379
            .:|..||.|..||:::.::...|.::|..|....      :||  .|:.|..|.|   |:|.:|.
  Fly   189 TVLAIEPKNIEAKRSLARINDRLRKIATKSGPNFTPDRPGMIEILPIEKPAYKRS---KKAMRSV 250

  Fly   380 PTV-----------------------------------VKKPEPVVSAKKPPPIKDYD------- 402
            |.|                                   |||..|     ||.|:.|..       
  Fly   251 PVVDVVSPRATIDDSNQLRISDEDIDKIFNSNCGIIEEVKKTNP-----KPTPMPDTSGPPKAET 310

  Fly   403 LAELVKPNRMVKSNLVSAAEALGNKMQA---------------SKGGAPKKP-------QSPPMT 445
            :|:..|..:..|...|..|.|:....:.               :|..||||.       |:....
  Fly   311 IAKTSKEVKPTKQTAVKVAPAVETPKETETRKDTKIVPESDNEAKPSAPKKTAVEVPKVQTQVSP 375

  Fly   446 PKETLLRLPQDNLNNSNKL 464
            ||.|:.|.|:.|...:.|:
  Fly   376 PKTTIERSPEVNTVQTEKI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 20/65 (31%)
TPR repeat 229..257 CDD:276809 10/27 (37%)
TPR repeat 262..293 CDD:276809 8/30 (27%)
TPR_11 266..329 CDD:290150 17/62 (27%)
TPR 266..297 CDD:197478 9/30 (30%)
TPR repeat 298..326 CDD:276809 7/27 (26%)
spagNP_524664.1 TPR_11 95..161 CDD:290150 20/75 (27%)
TPR repeat 96..124 CDD:276809 10/36 (28%)
TPR_1 102..129 CDD:278916 12/26 (46%)
TPR repeat 129..159 CDD:276809 8/30 (27%)
TPR 130..160 CDD:197478 8/30 (27%)
TPR_16 136..197 CDD:290168 18/60 (30%)
TPR repeat 164..192 CDD:276809 7/27 (26%)
RPAP3_C 415..503 CDD:290588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.