DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and CG14894

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster


Alignment Length:202 Identity:56/202 - (27%)
Similarity:96/202 - (47%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 EEILRMDLNEERDQEQR-EKIISNHSKSVTTDKLQS--------------ERDSLYERLQAQLKN 219
            |||...:....|..|:. ::|:...::....|:.:.              :.:...|.|:.:.|:
  Fly    17 EEITEKEATSTRQSEKDVDEIVEKQNQLALDDEAEQGAAGGDSIATPTTVDSELTIEELREREKD 81

  Fly   220 LS--QL--EKEQFAERHRLRGNESFKAKEYENAIEEYN-----CSIIYDPENAVHAYNNRAVAHL 275
            ||  ||  .||: |::.::.|||.||..:.|.|.:.|.     |......|.|| .|.|||.|.:
  Fly    82 LSPEQLTANKEK-ADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKERAV-LYGNRAAAKI 144

  Fly   276 KLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEK 340
            ||:...:||.||...:::.|..::..||.|:.:..|.|..|:|..|||:.:.:|....|::|..:
  Fly   145 KLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQQEAREAQIR 209

  Fly   341 LTSMLGE 347
            |..::.|
  Fly   210 LPPIINE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 24/70 (34%)
TPR repeat 229..257 CDD:276809 10/32 (31%)
TPR repeat 262..293 CDD:276809 13/30 (43%)
TPR_11 266..329 CDD:290150 22/62 (35%)
TPR 266..297 CDD:197478 12/30 (40%)
TPR repeat 298..326 CDD:276809 10/27 (37%)
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 24/72 (33%)
TPR repeat 94..122 CDD:276809 9/27 (33%)
TPR_11 132..198 CDD:290150 24/66 (36%)
TPR repeat 132..162 CDD:276809 13/30 (43%)
TPR_1 133..166 CDD:278916 14/33 (42%)
TPR 167..198 CDD:197478 10/30 (33%)
TPR repeat 167..195 CDD:276809 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.