Sequence 1: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262636.1 | Gene: | CG14894 / 41993 | FlyBaseID: | FBgn0038428 | Length: | 263 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 56/202 - (27%) |
---|---|---|---|
Similarity: | 96/202 - (47%) | Gaps: | 26/202 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 EEILRMDLNEERDQEQR-EKIISNHSKSVTTDKLQS--------------ERDSLYERLQAQLKN 219
Fly 220 LS--QL--EKEQFAERHRLRGNESFKAKEYENAIEEYN-----CSIIYDPENAVHAYNNRAVAHL 275
Fly 276 KLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEK 340
Fly 341 LTSMLGE 347 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Spag1 | NP_651514.1 | TPR_11 | 229..295 | CDD:290150 | 24/70 (34%) |
TPR repeat | 229..257 | CDD:276809 | 10/32 (31%) | ||
TPR repeat | 262..293 | CDD:276809 | 13/30 (43%) | ||
TPR_11 | 266..329 | CDD:290150 | 22/62 (35%) | ||
TPR | 266..297 | CDD:197478 | 12/30 (40%) | ||
TPR repeat | 298..326 | CDD:276809 | 10/27 (37%) | ||
CG14894 | NP_001262636.1 | TPR_11 | 93..164 | CDD:290150 | 24/72 (33%) |
TPR repeat | 94..122 | CDD:276809 | 9/27 (33%) | ||
TPR_11 | 132..198 | CDD:290150 | 24/66 (36%) | ||
TPR repeat | 132..162 | CDD:276809 | 13/30 (43%) | ||
TPR_1 | 133..166 | CDD:278916 | 14/33 (42%) | ||
TPR | 167..198 | CDD:197478 | 10/30 (33%) | ||
TPR repeat | 167..195 | CDD:276809 | 10/27 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462449 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |