Sequence 1: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956610.1 | Gene: | odad4 / 393286 | ZFINID: | ZDB-GENE-040426-995 | Length: | 486 | Species: | Danio rerio |
Alignment Length: | 279 | Identity: | 55/279 - (19%) |
---|---|---|---|
Similarity: | 108/279 - (38%) | Gaps: | 53/279 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 GNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKA 300
Fly 301 HLRMAEAHNAEGKHLESLNVYKKLLDFEPD----NAIAKKAVEKLTSMLGEVAPSSATRLIIE-- 359
Fly 360 ------EIDPPQLKTSEPK------KEAEKSEPTVVKKPEPVVSAKK--PPPIKDYDLAEL-VKP 409
Fly 410 NRMVKSNLVSAAEALGNKMQASKGGAP----------------KKPQSPPMTPKETLLR------ 452
Fly 453 ------LPQDNLNNSNKLL 465 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Spag1 | NP_651514.1 | TPR_11 | 229..295 | CDD:290150 | 14/58 (24%) |
TPR repeat | 229..257 | CDD:276809 | 6/20 (30%) | ||
TPR repeat | 262..293 | CDD:276809 | 7/30 (23%) | ||
TPR_11 | 266..329 | CDD:290150 | 13/62 (21%) | ||
TPR | 266..297 | CDD:197478 | 6/30 (20%) | ||
TPR repeat | 298..326 | CDD:276809 | 7/27 (26%) | ||
odad4 | NP_956610.1 | TPR 1. /evidence=ECO:0000255 | 14..47 | 7/25 (28%) | |
TPR_11 | 16..79 | CDD:290150 | 14/58 (24%) | ||
TPR repeat | 16..42 | CDD:276809 | 6/20 (30%) | ||
TPR repeat | 47..77 | CDD:276809 | 7/30 (23%) | ||
TPR 2. /evidence=ECO:0000255 | 49..81 | 6/31 (19%) | |||
TPR_11 | 50..113 | CDD:290150 | 13/62 (21%) | ||
TPR 3. /evidence=ECO:0000255 | 82..115 | 8/32 (25%) | |||
TPR repeat | 82..110 | CDD:276809 | 7/27 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 153..180 | 7/26 (27%) | |||
TPR_12 | 313..379 | CDD:290160 | |||
TPR 4. /evidence=ECO:0000255 | 314..347 | ||||
TPR repeat | 316..342 | CDD:276809 | |||
TPR repeat | 347..383 | CDD:276809 | |||
TPR 5. /evidence=ECO:0000255 | 354..387 | ||||
TPR_12 | 355..423 | CDD:290160 | |||
TPR 6. /evidence=ECO:0000255 | 391..424 | ||||
TPR 7. /evidence=ECO:0000255 | 431..464 | ||||
TPR repeat | 431..459 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |