DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Tmtc3

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster


Alignment Length:402 Identity:72/402 - (17%)
Similarity:138/402 - (34%) Gaps:131/402 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YPDLQRCAEE-----KLKALKPDSK-----------------------LFRYEEQIKQSTDLDKT 85
            :.:|:|.||.     :.|||.|.:|                       :.:.:.:::::..|.:.
  Fly   558 FNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQ 622

  Fly    86 ELKPILDWTDAIKTKDNALNELKKVKQ------------NLNLPSVRKLSKIDLEKESKTEKPKP 138
            .:....|:..|...:.:.|.:|.:..|            |.|......|..:.||:         
  Fly   623 AISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQ--------- 678

  Fly   139 APKATSPSNTKNKEARIKSTDYRKWDKYDPDEE-------ILRMDLNEE--------------RD 182
                     .|:::|::.   :.|..:..|:.|       ||..:|..|              .:
  Fly   679 ---------GKSQQAQVY---FNKAIELYPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLEN 731

  Fly   183 QEQREKIISNHSKSVTTDKLQSERDSLYER-------LQAQLKNLSQLEKE------------QF 228
            .:|.||:..|.......:....|.:..::|       .::.|.||:.|..:            |.
  Fly   732 DDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLDAVPFLNQL 796

  Fly   229 AERH--RLRG---------NESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFS 282
            ...|  .::|         |.   .|:.:.|.:.|...:.|||.| ....:|..|..::.|:   
  Fly   797 IRHHPSHVKGLILLGDIYINH---MKDLDEAEKCYRSILHYDPHN-TQGLHNLCVVFVERKR--- 854

  Fly   283 AISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLE----SLNVYKKLLDFEPDNAIAKKAVEKLTS 343
             ::...||||...       |:|.|.:..|:||:    .|....||.:..|:..:|.:..:.|..
  Fly   855 -LAKAAACLQYAQ-------RLAPAEDYIGRHLQIVLARLQKINKLPESAPERKLAYEDYDPLEF 911

  Fly   344 MLGEVAPSSATR 355
            .|.:..|:..:|
  Fly   912 KLPQDRPTHKSR 923

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 17/76 (22%)
TPR repeat 229..257 CDD:276809 6/38 (16%)
TPR repeat 262..293 CDD:276809 7/30 (23%)
TPR_11 266..329 CDD:290150 16/66 (24%)
TPR 266..297 CDD:197478 7/30 (23%)
TPR repeat 298..326 CDD:276809 9/31 (29%)
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 59/348 (17%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809 9/32 (28%)
TPR repeat 598..625 CDD:276809 1/26 (4%)
TPR repeat 630..660 CDD:276809 4/29 (14%)
TPR repeat 665..693 CDD:276809 6/48 (13%)
TPR repeat 737..764 CDD:276809 4/26 (15%)
TPR repeat 803..834 CDD:276809 5/33 (15%)
TPR repeat 839..867 CDD:276809 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.