DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Dpit47

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster


Alignment Length:282 Identity:69/282 - (24%)
Similarity:114/282 - (40%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DEEILRMDLNEERDQE------QREKIISNHSKSVTTDKLQSERDS-----------------LY 210
            |||  |::|..:.|.|      ..||  ..:.:....|:.|.|.|.                 ::
  Fly    12 DEE--RLELAAQLDAELDAFIDGLEK--KRYEEGWPEDRWQEEMDKHPFFMKRAPQPGDDVHPMF 72

  Fly   211 ERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSI---IYDPENAVHAYNNRAV 272
            |.||....:..:..:::.|..::..||...|.|::..||..:...|   ..:|:.....||||:.
  Fly    73 EGLQKLKYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYNNRSA 137

  Fly   273 AHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAE-AHNAEGKHLESLNVYKKLLDFEPDNAIA-- 334
            ||..:|.|.|::||.|..|...|...||..|.|: |:..|...| ...:.::||:.:.||.:|  
  Fly   138 AHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERFDL-CTQMCEELLEVDVDNEVAIA 201

  Fly   335 --------KKAVEKLTSMLGEVAPSSATRL--IIEEIDPPQLKTSEPK--KEAEKSEPTVVKKPE 387
                    |..:|:........|....||.  :.:.|:...:|..:.|  |:...||..:..|..
  Fly   202 LLHKNKMKKLEIERNQRKEAAEAKRRLTRFHRLRDAIEQRAIKFDDQKVGKKDVLSEELLYPKFL 266

  Fly   388 PVVSAKKPPPIKDYDLAELVKP 409
            |:   :..|...|.|.:.|:.|
  Fly   267 PL---EDHPVHLDEDGSTLIWP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 22/68 (32%)
TPR repeat 229..257 CDD:276809 8/30 (27%)
TPR repeat 262..293 CDD:276809 13/30 (43%)
TPR_11 266..329 CDD:290150 23/63 (37%)
TPR 266..297 CDD:197478 14/30 (47%)
TPR repeat 298..326 CDD:276809 8/28 (29%)
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 29/94 (31%)
TPR repeat 91..119 CDD:276809 7/27 (26%)
TPR repeat 124..158 CDD:276809 14/33 (42%)
TPR repeat 163..191 CDD:276809 8/28 (29%)
TPR repeat 197..227 CDD:276809 4/29 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.