DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and aip

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_999877.1 Gene:aip / 334795 ZFINID:ZDB-GENE-030131-6735 Length:342 Species:Danio rerio


Alignment Length:202 Identity:46/202 - (22%)
Similarity:73/202 - (36%) Gaps:65/202 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 KIISNHSKS-VTTDKLQSERDSL---YERLQAQLKNLSQLEKEQFAERHRL--------RGNESF 240
            ::.|:||.. ...|||||....|   .|.||.......|.|.....:..:|        .||..|
Zfish   127 QVHSHHSLGHHDLDKLQSNPQPLIFTLELLQVLSPGSYQQEIWAMTDDEKLGAIPQIHEEGNALF 191

  Fly   241 KAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLK----------------------------- 276
            |:.:...|.|:|              ||  |:|.||                             
Zfish   192 KSGDISGAAEKY--------------YN--AIACLKSLQMKERPGDEHWIKLDLMITPLLLNYCQ 240

  Fly   277 ----LKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEP--DNAIAK 335
                |.:|:..:..|.:.:.....|:||:.:..:||.|.....|:...:.|:|..:|  :.:|||
Zfish   241 CKLLLGQYYEVLDHCSSIINKYEDNVKAYFKRGKAHAAVWNEAEARADFAKVLTLDPSLEASIAK 305

  Fly   336 --KAVEK 340
              :|:|:
Zfish   306 ELRAMEE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 17/106 (16%)
TPR repeat 229..257 CDD:276809 8/35 (23%)
TPR repeat 262..293 CDD:276809 9/63 (14%)
TPR_11 266..329 CDD:290150 18/95 (19%)
TPR 266..297 CDD:197478 9/63 (14%)
TPR repeat 298..326 CDD:276809 7/27 (26%)
aipNP_999877.1 FKBP_C 30..>91 CDD:278674
TPR repeat 184..226 CDD:276809 13/57 (23%)
TPR repeat 231..261 CDD:276809 3/29 (10%)
TPR_11 <245..297 CDD:290150 12/51 (24%)
TPR repeat 266..293 CDD:276809 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.