DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and CG4341

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster


Alignment Length:191 Identity:39/191 - (20%)
Similarity:71/191 - (37%) Gaps:51/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 ERDQEQREKIISNHSKSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKE 244
            |:.:.||...|...:.| :...|..:|:.||:|:...|..|.|.::   ||||.           
  Fly   727 EQGKLQRALAIYREALS-SLPGLPQQREILYQRIGDVLGRLQQWDE---AERHH----------- 776

  Fly   245 YENAIEEYNCSIIYDPENAVHAYNNRAVAHLK----LKKYFSAISDCQ----ACLQIDPMNIKAH 301
                            ..|:....|:..|||.    |.:..|..|:.:    ..|::.|.....:
  Fly   777 ----------------RAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVY 825

  Fly   302 LRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRLIIEEID 362
            ...||..:.:.:|.||...:::..:..|::...            .||.::|.||:..::|
  Fly   826 HHYAEFLSLQSRHHESAIYHRRAAELAPNDYTL------------VVAAATAMRLLDRKVD 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 13/73 (18%)
TPR repeat 229..257 CDD:276809 4/27 (15%)
TPR repeat 262..293 CDD:276809 9/38 (24%)
TPR_11 266..329 CDD:290150 14/70 (20%)
TPR 266..297 CDD:197478 9/38 (24%)
TPR repeat 298..326 CDD:276809 5/27 (19%)
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150
TPR_1 602..634 CDD:278916
TPR repeat 602..630 CDD:276809
TPR repeat 635..665 CDD:276809
TPR_11 636..700 CDD:290150
TPR_1 636..668 CDD:278916
TPR repeat 670..694 CDD:276809
TPR_11 714..784 CDD:290150 18/87 (21%)
TPR repeat 715..743 CDD:276809 4/15 (27%)
TPR repeat 748..782 CDD:276809 13/63 (21%)
TPR_11 755..819 CDD:290150 19/93 (20%)
TPR repeat 787..816 CDD:276809 6/28 (21%)
TPR_11 821..887 CDD:290150 12/66 (18%)
TPR repeat 822..850 CDD:276809 5/27 (19%)
TPR repeat 855..885 CDD:276809 6/32 (19%)
TPR_11 <874..921 CDD:290150 1/1 (100%)
TPR repeat 890..918 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.