DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and CG1847

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster


Alignment Length:321 Identity:61/321 - (19%)
Similarity:119/321 - (37%) Gaps:89/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KTELKPI-----------LDWTDAIKTK----------DNALNELKKVKQNLNL----------- 116
            |:::|||           ::.|...:.|          ...:::.:|:::.:.|           
  Fly     6 KSDMKPIRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVW 70

  Fly   117 ------PSVRKLSKIDLEKE--------SKTEK---PKPAPKATSPSNTKNKEARIKSTDYRKWD 164
                  .|:.:::|..:.|.        |||.:   .||..:......|...|    ...|...|
  Fly    71 ELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTLQNE----GIGYTDLD 131

  Fly   165 K--YDPDE-----EILRMDLNEERDQEQREKIISNHSKSVTTDKLQSERDSLYERLQAQLKNLSQ 222
            :  .:|.:     |:..::|.|:.::|:.:  :|:..|.:.|..|:...::.|:        .|:
  Fly   132 ELLQNPSDLEFIIELFSIELPEQYEKERWQ--MSDDEKMLATSTLRERGNNFYK--------ASR 186

  Fly   223 LEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDC 287
            ..:.:...|..:...|....||..:..|....:.|..|     ...|.|...|....:::.|..|
  Fly   187 FTEAETCYREAVGIVEQLMLKEKPHDEEWQELAAIKTP-----LLLNYAQCRLIAGDFYAVIEHC 246

  Fly   288 QACLQIDPMNIKAHLRMAEAH-------NAEGKHLESLNVYKKLLDFEPDNAIAK--KAVE 339
            ...|.:||.|:||..|.|:||       .|....|::|     .||....:.::|  |::|
  Fly   247 NEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDAL-----ALDASLKSTVSKELKSIE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 13/65 (20%)
TPR repeat 229..257 CDD:276809 5/27 (19%)
TPR repeat 262..293 CDD:276809 6/30 (20%)
TPR_11 266..329 CDD:290150 20/69 (29%)
TPR 266..297 CDD:197478 8/30 (27%)
TPR repeat 298..326 CDD:276809 9/34 (26%)
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 7/68 (10%)
3a0801s09 150..>308 CDD:273380 39/173 (23%)
TPR repeat 173..217 CDD:276809 8/51 (16%)
TPR repeat 222..252 CDD:276809 7/34 (21%)
TPR repeat 257..285 CDD:276809 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.