DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and HIP

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_570074.3 Gene:HIP / 318211 FlyBaseID:FBgn0260484 Length:377 Species:Drosophila melanogaster


Alignment Length:442 Identity:95/442 - (21%)
Similarity:148/442 - (33%) Gaps:161/442 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ELKKVK-------QN---LNLPSVRKLSKIDLEKESKTEKP----------------KPAPKATS 144
            :|||:|       :|   ||:|.: :..|..:||...|..|                ....||..
  Fly     9 DLKKLKYFIDFALENPTFLNMPQL-QFVKDFVEKFGGTVPPGQFNGGSAGGKCPFGGVAGAKANE 72

  Fly   145 PSNTKNKEARIKSTDYRKWDKYDPDEEI-LRMDLNEERDQEQREKIISNHSKSVTTDKLQSERDS 208
            |:|........||..       ||:.:: |.|:...|.|.:..:. :.|:||..|.:        
  Fly    73 PANAPEDSEDEKSLS-------DPESDVELDMEGVIEADSDPAQP-MGNYSKKATEE-------- 121

  Fly   209 LYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAV-HAYNNRAV 272
                           |.||.:|. |.:...::..::::.||..|..:|...|.||: ||  .|..
  Fly   122 ---------------EVEQASEL-RAQAASAYGQQKFDEAIALYTKAIELSPGNALFHA--KRGQ 168

  Fly   273 AHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKL---------LDFE 328
            |.|||||..:.|.||...|:::.       .:|..:...|:....|..::..         |||:
  Fly   169 AFLKLKKPNACIRDCDVALELNS-------DLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFD 226

  Fly   329 PDNAIAKKAVEKLTSMLGEVAPSS--------------ATRLIIEEIDPPQLKTSEPKKEAEK-- 377
                      |:....|.||.|::              |.|.|.|.    |......:||.||  
  Fly   227 ----------EETDEWLKEVTPNAKKIEQHRLKQERRQAERKIKER----QRDQRRARKEQEKHN 277

  Fly   378 ---------------------------SEPTVVKKPEPVVS--------AKKPPPIKDYDLAELV 407
                                       |:|.|....:.::|        |..|   |.|:|.:.:
  Fly   278 ASSGGSSGEFSGGNPGNGNMSDILGAMSDPEVSAAIQDILSNPGNITKYASNP---KIYNLIKKI 339

  Fly   408 KPNRMVKSNLVSAAEALGNKMQASKGGAPKKPQSPPMTPKETLLRLPQDNLN 459
            .|...|.:....|.|         |.|.|.:|:     ||:.......|.|:
  Fly   340 VPGGDVGAAFGQAGE---------KAGKPSEPK-----PKKDSADFVDDGLD 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 22/66 (33%)
TPR repeat 229..257 CDD:276809 5/27 (19%)
TPR repeat 262..293 CDD:276809 15/31 (48%)
TPR_11 266..329 CDD:290150 18/71 (25%)
TPR 266..297 CDD:197478 12/30 (40%)
TPR repeat 298..326 CDD:276809 3/36 (8%)
HIPNP_570074.3 Hip_N 10..47 CDD:271228 12/37 (32%)
TPR_11 125..190 CDD:290150 23/67 (34%)
TPR_2 126..159 CDD:285020 7/33 (21%)
TPR repeat 126..154 CDD:276809 5/28 (18%)
TPR repeat 159..189 CDD:276809 15/31 (48%)
TPR repeat 194..222 CDD:276809 3/27 (11%)
STI1 299..336 CDD:128966 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.