DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Ifit2

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001019924.1 Gene:Ifit2 / 294091 RGDID:1307804 Length:464 Species:Rattus norvegicus


Alignment Length:256 Identity:59/256 - (23%)
Similarity:98/256 - (38%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NTKNKEARIKSTDYRK----WDKYDPDEEILRMDLNEERDQEQREKIISNHSKSVTTDKLQSERD 207
            :|.:||:...|....|    |:....||     .|:|..|:...:....|.....|...|.:...
  Rat     2 STASKESLESSLQQLKCHFTWNLRAEDE-----SLDEFEDRVFNKDEFQNSEFKATMCNLLAYVK 61

  Fly   208 SLYERLQAQLKNLSQLE---KEQFAERHRLR-----GNESF---------KAKEYENAIEEYNCS 255
            ......:|.||.|.:.|   ::|..::..::     ||.::         ||:||.:.:::. |.
  Rat    62 HCRGLNEAALKCLGEAEDFIRQQHPDQIEIKSLVTWGNYAWVYYHMGQLSKAQEYLDKVKQV-CK 125

  Fly   256 IIYDP---ENAVHAYNNRAVAHLK-LKKYFSAISDC-QACLQIDPMNIKAHLRMAEAH------N 309
            ....|   ||.| .......|.|| .|.....:..| :..|:.||.|.::....|.|:      .
  Rat   126 KFSSPYRIENPV-LDCEEGWARLKCTKNQNERMKVCFEKALEKDPKNPESTSGWAIANYRLDDWP 189

  Fly   310 AEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRLIIEEI--DPPQLKT 368
            |...:::||   ::.:...|||...|..   |...|.||..:.|..|:.|.:  ||..:.|
  Rat   190 ASNDYIDSL---EQAISLSPDNTYVKVL---LAMKLEEVHENRAKELVEEALKKDPSAIDT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 17/84 (20%)
TPR repeat 229..257 CDD:276809 7/41 (17%)
TPR repeat 262..293 CDD:276809 8/32 (25%)
TPR_11 266..329 CDD:290150 14/70 (20%)
TPR 266..297 CDD:197478 8/32 (25%)
TPR repeat 298..326 CDD:276809 5/33 (15%)
Ifit2NP_001019924.1 TPR_12 51..126 CDD:290160 15/75 (20%)
TPR repeat 96..122 CDD:276809 6/25 (24%)
TPR repeat 127..167 CDD:276809 10/40 (25%)
TPR repeat 242..270 CDD:276809 1/3 (33%)
TPR repeat 275..325 CDD:276809
TPR repeat 330..355 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.