| Sequence 1: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_796342.2 | Gene: | Tmtc2 / 278279 | MGIID: | 1914057 | Length: | 836 | Species: | Mus musculus |
| Alignment Length: | 328 | Identity: | 66/328 - (20%) |
|---|---|---|---|
| Similarity: | 116/328 - (35%) | Gaps: | 100/328 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 194 SKSVTTDKLQSERDSLYER--LQAQLKNLSQL--EKEQFAERHRLRGNESFKAKEYENAIEEYNC 254
Fly 255 SIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIK---AH--------LRMAEAH 308
Fly 309 NAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEV------------------------- 348
Fly 349 --------------APSSATRLIIE--EIDPPQ-----------LKTSE-------PKKEAE--K 377
Fly 378 SEPTVVKKPEPVV--SAKKPPPIKDYDLAELVKPNRMVKSNLVSAAEALGNKMQASKGGAPKKPQ 440
Fly 441 SPP 443 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Spag1 | NP_651514.1 | TPR_11 | 229..295 | CDD:290150 | 14/65 (22%) |
| TPR repeat | 229..257 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 262..293 | CDD:276809 | 7/30 (23%) | ||
| TPR_11 | 266..329 | CDD:290150 | 16/73 (22%) | ||
| TPR | 266..297 | CDD:197478 | 7/30 (23%) | ||
| TPR repeat | 298..326 | CDD:276809 | 8/38 (21%) | ||
| Tmtc2 | NP_796342.2 | DUF1736 | 247..321 | CDD:285594 | |
| TPR 1 | 460..492 | ||||
| TPR_11 | 493..554 | CDD:290150 | 15/65 (23%) | ||
| TPR 2 | 493..526 | 5/20 (25%) | |||
| TPR repeat | 493..521 | CDD:276809 | 3/15 (20%) | ||
| TPR_1 | 493..>520 | CDD:278916 | 3/14 (21%) | ||
| TPR 3 | 527..560 | 12/49 (24%) | |||
| TPR repeat | 527..555 | CDD:276809 | 10/44 (23%) | ||
| TPR_12 | 557..634 | CDD:290160 | 18/77 (23%) | ||
| TPR repeat | 560..590 | CDD:276809 | 7/30 (23%) | ||
| TPR 4 | 562..594 | 7/31 (23%) | |||
| TPR repeat | 595..634 | CDD:276809 | 8/38 (21%) | ||
| TPR 5 | 606..639 | 6/32 (19%) | |||
| TPR_2 | 609..639 | CDD:285020 | 6/29 (21%) | ||
| ANAPC3 | 618..703 | CDD:289650 | 13/88 (15%) | ||
| TPR repeat | 642..671 | CDD:276809 | 4/28 (14%) | ||
| TPR 6 | 643..676 | 4/32 (13%) | |||
| TPR 7 | 677..710 | 5/32 (16%) | |||
| TPR repeat | 679..705 | CDD:276809 | 2/25 (8%) | ||
| TPR repeat | 710..774 | CDD:276809 | 14/63 (22%) | ||
| TPR 8 | 712..744 | 6/31 (19%) | |||
| TPR 9 | 746..778 | 8/31 (26%) | |||
| TPR_19 | 755..822 | CDD:291240 | 12/56 (21%) | ||
| TPR 10 | 779..812 | 5/32 (16%) | |||
| TPR_1 | 779..812 | CDD:278916 | 5/32 (16%) | ||
| TPR repeat | 779..807 | CDD:276809 | 3/27 (11%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||