DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Ogt

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006257118.1 Gene:Ogt / 26295 RGDID:62060 Length:1046 Species:Rattus norvegicus


Alignment Length:167 Identity:36/167 - (21%)
Similarity:63/167 - (37%) Gaps:37/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LKNLSQLEKEQ-------------------FAERHRLRGNESFKAKEYENAIEEYNCSIIYDPEN 262
            |.||:.:::||                   ||..|....:...:..:.:.|:..|..:|...|..
  Rat   330 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTF 394

  Fly   263 AVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDF 327
            | .||:|......:::....|:......:||:|....||..:|..|...|...|::..|:..|..
  Rat   395 A-DAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKL 458

  Fly   328 EPD--NAIAKKA---------------VEKLTSMLGE 347
            :||  :|....|               ::||.|::.|
  Rat   459 KPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVAE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 13/65 (20%)
TPR repeat 229..257 CDD:276809 4/27 (15%)
TPR repeat 262..293 CDD:276809 5/30 (17%)
TPR_11 266..329 CDD:290150 15/62 (24%)
TPR 266..297 CDD:197478 7/30 (23%)
TPR repeat 298..326 CDD:276809 7/27 (26%)
OgtXP_006257118.1 PEP_TPR_lipo <22..>465 CDD:274350 30/135 (22%)
TPR repeat 24..49 CDD:276809
TPR repeat 57..83 CDD:276809
TPR repeat 89..117 CDD:276809
TPR repeat 122..152 CDD:276809
TPR repeat 157..185 CDD:276809
TPR repeat 191..219 CDD:276809
TPR repeat 226..253 CDD:276809
TPR repeat 259..287 CDD:276809
TPR repeat 293..321 CDD:276809
TPR repeat 327..355 CDD:276809 5/24 (21%)
TPR repeat 360..390 CDD:276809 6/29 (21%)
TPR repeat 395..423 CDD:276809 5/28 (18%)
TPR repeat 429..457 CDD:276809 7/27 (26%)
Glyco_transf_41 476..1016 CDD:404688 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.