DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and IFIT5

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_036552.1 Gene:IFIT5 / 24138 HGNCID:13328 Length:482 Species:Homo sapiens


Alignment Length:481 Identity:88/481 - (18%)
Similarity:150/481 - (31%) Gaps:196/481 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KSLLERYNIPIHYLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKLKALKPDSKLFR 71
            ||.|..||:      .|:|:..                 :|...|...|.|:             
Human    48 KSRLALYNL------LAYVKHL-----------------KGQNKDALECLEQ------------- 76

  Fly    72 YEEQIKQSTDLDKTELKPILDW---------TDAIKTKDNALNELKKVKQNLNLPSVRKLS--KI 125
             .|:|.|....||.|::.::.|         .|.::.......::..|.:.|:.||..||.  :.
Human    77 -AEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCKKLSSPSNYKLECPET 140

  Fly   126 DLEK--------ESKTEKPKPA-PKA--TSPSNTK---------------NKEARIKSTD---YR 161
            |.||        ....:|.|.| .||  ..|.|.:               ::|..:||..   .|
Human   141 DCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDREGSVKSFSLGPLR 205

  Fly   162 KWDKYDPDEEILRM-------DLNEERDQEQ---------------------------------- 185
            |....:||...:::       |::.|.:.|:                                  
Human   206 KAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLRYAAKFYRRKNSWNKALE 270

  Fly   186 -----------------------REKII----SNHSKSVTTDKLQ---------------SERDS 208
                                   |.::|    :.|::....|||:               .||||
Human   271 LLKKALEVTPTSSFLHHQMGLCYRAQMIQIKKATHNRPKGKDKLKVDELISSAIFHFKAAMERDS 335

  Fly   209 LYERLQAQLKNLSQLEKEQFAERHRLRGNESF--KAKEYENAIEEYNCSIIY----------DPE 261
            ::......|.|:       :||..:....|..  ||...||..:::...|.|          ..|
Human   336 MFAFAYTDLANM-------YAEGGQYSNAEDIFRKALRLENITDDHKHQIHYHYGRFQEFHRKSE 393

  Fly   262 N-AVHAY------NNRAVAHLKLKKYFSAISDCQACLQ-IDPMNIKAHLRMAEAHNAEGKHLESL 318
            | |:|.|      .:|:....||......:|..:.|.. :|..::.|   :...:..||:..::.
Human   394 NTAIHHYLEALKVKDRSPLRTKLTSALKKLSTKRLCHNALDVQSLSA---LGFVYKLEGEKRQAA 455

  Fly   319 NVYKKLLDFEPDNAIAKKAVEKLTSM 344
            ..|:|....:|:||      |.||::
Human   456 EYYEKAQKIDPENA------EFLTAL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 19/85 (22%)
TPR repeat 229..257 CDD:276809 7/29 (24%)
TPR repeat 262..293 CDD:276809 9/38 (24%)
TPR_11 266..329 CDD:290150 12/69 (17%)
TPR 266..297 CDD:197478 7/37 (19%)
TPR repeat 298..326 CDD:276809 5/27 (19%)
IFIT5NP_036552.1 TPR_12 49..116 CDD:315987 18/103 (17%)
TPR 1 51..84 12/69 (17%)
TPR repeat 53..79 CDD:276809 8/62 (13%)
TPR repeat 84..133 CDD:276809 9/48 (19%)
TPR 2 94..127 3/32 (9%)
TPR 3 138..173 9/34 (26%)
TPR repeat 138..168 CDD:276809 8/29 (28%)
PEP_TPR_lipo <157..470 CDD:274350 57/328 (17%)
TPR 4 181..214 6/32 (19%)
TPR repeat 214..244 CDD:276809 3/29 (10%)
TPR 5 249..282 0/32 (0%)
TPR repeat 249..277 CDD:276809 0/27 (0%)
Interaction with the 5'-triphosphate group of PPP-RNA 254..260 0/5 (0%)
TPR repeat 282..333 CDD:276809 6/50 (12%)
TPR 6 338..371 9/39 (23%)
TPR repeat 338..366 CDD:276809 7/34 (21%)
TPR 7 376..410 7/33 (21%)
TPR repeat 376..405 CDD:276809 7/28 (25%)
TPR 8 435..468 6/35 (17%)
TPR repeat 435..463 CDD:276809 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.