DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Tmtc3

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001103483.1 Gene:Tmtc3 / 237500 MGIID:3036255 Length:920 Species:Mus musculus


Alignment Length:438 Identity:90/438 - (20%)
Similarity:165/438 - (37%) Gaps:118/438 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PIH---YLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKLKALKPDSKLFRYEEQIK 77
            |.|   |::.|::.:...:| :|:..|:.|...... ||.::....:.:.|...:|..:.:|...
Mouse   530 PNHLNVYINLANLIRANESR-LEEADQLYRQAISMR-PDFKQAYISRGELLLKMNKPLKAKEAYL 592

  Fly    78 QSTDLDKTELKPILDWTDA----IKTKDNALNE-LKKVKQNLNLPSVRKLSKID---LEKESKTE 134
            ::.:||:.....   |.:.    |:.|:.  || ||...:.|.|....||:..:   |.:||...
Mouse   593 KALELDRNNADL---WYNLAIVYIELKEP--NEALKNFNRALELNPKHKLALFNSAILMQESGEV 652

  Fly   135 KPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDE----EILRMDLNEERDQEQREKIISNHSK 195
            |.:|             |||.:..:|...:..|.:.    .:|.||..::.:.|...|      |
Mouse   653 KLRP-------------EARKRLLNYVNEEPQDANGYFNLGMLAMDDKKDSEAESWMK------K 698

  Fly   196 SVTTDKLQSERDS-------LYERLQAQLKNLSQLEK--EQFAERHR---LRGNESFKAKE---- 244
            ::   |||.:..|       ||.:...:||.|..||:  :.:.:..:   |:|:.....|:    
Mouse   699 AI---KLQPDFRSALFNLALLYSQTAKELKALPILEELLKYYPDHTKGLILKGDILMNQKKDIPG 760

  Fly   245 ----YENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMA 305
                :|..:|       .||.| |...:|..|.:.:.|:...|    :.|| ::.:.:..|....
Mouse   761 AKKCFEKILE-------MDPSN-VQGKHNLCVVYFEEKELLKA----ERCL-VETLALAPHEEYI 812

  Fly   306 EAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLG----EVAPSSATRLIIEEIDPPQL 366
            :.|         |::.:   |....:.|.::.:.......|    |..||...:.|..|..|||:
Mouse   813 QRH---------LSIVR---DRISSSGIVEQPLAPADKTPGTEEREEIPSEDVKEISSESRPPQI 865

  Fly   367 -------------------------KTSEPKKEAEKSEPTVVKKPEPV 389
                                     ||::..||.||.....:|:.|.:
Mouse   866 LKTNNNRNSKSNKQSTENADQDAPHKTTKDIKEIEKKRVAALKRLEEI 913

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 15/76 (20%)
TPR repeat 229..257 CDD:276809 5/38 (13%)
TPR repeat 262..293 CDD:276809 8/30 (27%)
TPR_11 266..329 CDD:290150 10/62 (16%)
TPR 266..297 CDD:197478 6/30 (20%)
TPR repeat 298..326 CDD:276809 3/27 (11%)
Tmtc3NP_001103483.1 DUF1736 263..336 CDD:369859
TPR 1 417..450
PEP_TPR_lipo <448..807 CDD:274350 68/318 (21%)
TPR 2 451..484
TPR repeat 451..479 CDD:276809
TPR repeat 484..528 CDD:276809
TPR 3 486..518
TPR 4 533..567 7/35 (20%)
TPR repeat 535..562 CDD:276809 6/27 (22%)
TPR repeat 567..597 CDD:276809 3/29 (10%)
TPR 5 568..601 5/32 (16%)
TPR 6 602..635 9/37 (24%)
TPR repeat 602..630 CDD:276809 7/32 (22%)
TPR 7 673..706 9/41 (22%)
TPR repeat 673..702 CDD:276809 6/37 (16%)
TPR repeat 707..735 CDD:276809 8/27 (30%)
TPR 8 708..740 8/31 (26%)
TPR 9 741..775 7/40 (18%)
TPR repeat 741..770 CDD:276809 4/28 (14%)
TPR repeat 776..799 CDD:276809 5/26 (19%)
TPR 10 777..809 6/36 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 829..897 11/67 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.