DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Spag1 and KDM6B

DIOPT Version :9

Sequence 1:	NP_651514.1	Gene:	Spag1 / 43239	FlyBaseID:	FBgn0039463	Length:	469	Species:	Drosophila melanogaster
Sequence 2:	NP_001073893.1	Gene:	KDM6B / 23135	HGNCID:	29012	Length:	1682	Species:	Homo sapiens

Alignment Length:	132	Identity:	26/132 - (19%)
Similarity:	44/132 - (33%)	Gaps:	15/132 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   347 EVAPSSATRLIIEEIDPPQLKTSEPKKEAEKSEPTVVKKPEPVV-----SAKKPPPIKDYDLAEL 406
            :.||::....:..........|:...:|.||..|..:..|.|:.     |..:|||......|.|
Human   739 DTAPTTTAPAVAVTTTTTTTTTTTATQEEEKKPPPALPPPPPLAKFPPPSQPQPPPPPPPSPASL 803

  Fly   407 VKPNRMVKSNLVSAAEALGNKMQASKGGAPKKPQS----------PPMTPKETLLRLPQDNLNNS 461
            :|....|...........|..:....|..|....|          ||.:...:....||.:.::|
Human   804 LKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPGPPSGATALPPTSAAPSAQGSPQPSASSS 868

  Fly   462 NK 463
            ::
Human   869 SQ 870

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Spag1	NP_651514.1	TPR_11	229..295	CDD:290150
		TPR repeat	229..257	CDD:276809
		TPR repeat	262..293	CDD:276809
		TPR_11	266..329	CDD:290150
		TPR	266..297	CDD:197478
		TPR repeat	298..326	CDD:276809
KDM6B	NP_001073893.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	52..88
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	190..680
		Mito_fiss_reg	<566..640	CDD:283069
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	704..807		16/67 (24%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	822..1096		9/49 (18%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1288..1325
		JmjC	1343..1407	CDD:214721
		JmjC	1377..1485	CDD:202224
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900