DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and Uty

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_017174175.1 Gene:Uty / 22290 MGIID:894810 Length:1236 Species:Mus musculus


Alignment Length:488 Identity:95/488 - (19%)
Similarity:173/488 - (35%) Gaps:136/488 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKLKALKPDSKLFRYEEQIKQSTDLD 83
            ||:.|..:.|.|...:...::.|::         |.|                   .:.||:..:
Mouse   394 YLNAARSKSCNNTSALTSRIKFLQA---------QLC-------------------NLPQSSLQN 430

  Fly    84 KTELKPILD--WT----DAIKTKDNALNELKK-VKQNLNLPSVRKLSKIDLEKESKTE------- 134
            ||:|.|.::  |:    ..:.::..|:|..:: |....|  ||:..|...::::..|:       
Mouse   431 KTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQSVSDTWN--SVQTASHHSVQQKVYTQCFTAQKL 493

  Fly   135 ----KPKPAPKAT--------SPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQRE 187
                |.:..|..|        :.:|.:|:..   :....:..|.|.....||:..:||      :
Mouse   494 QSFGKDQQPPFQTGSTRYLQAASTNDQNQNG---NHTLPQNSKGDAQNHFLRIPTSEE------Q 549

  Fly   188 KIIS-------NHSKSVTTDKLQSERDS-------------LYERLQAQLKNLSQLEKEQFAERH 232
            |||:       :.|||:|:...:.:||:             :|:.....:.:|:  .||..:...
Mouse   550 KIINFTKESKDSRSKSLTSKTSRKDRDTSNICVNAKKHSNHIYQISSVPISSLN--NKESVSPDL 612

  Fly   233 RLRGNESFKAKEYENAIEEYNCSI-IYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPM 296
            .:..|........| .|:..:..| ..|..|.||...::...:|......||||.....|::...
Mouse   613 IIVDNPQLSVLVGE-TIDNVDHDIGTCDKVNNVHLAIHKKPDNLSASSPSSAISTETLSLKLTEQ 676

  Fly   297 N------IKAHLRMAEAHNAEG-KHLE---SLNVYKKLLDFEPDNAI----------AKKAVEKL 341
            .      |..|..: ...|.|| ::||   |:||     ...|.:.|          :...|.|.
Mouse   677 THIVTSFISPHSGL-HTINGEGHENLESSASVNV-----GLRPRSQIIPSMSVSIYSSSTEVLKA 735

  Fly   342 TSMLGEVAPSSATRLIIEEIDPPQLKTSE-PKKEAEKSEPTVVKKPEPVVSAKKP-----PPIKD 400
            ...||:...|:. .::::...||:..||. |....||..|     |.|.:..:..     ||:..
Mouse   736 CRSLGKNGLSNG-HILLDICPPPRPPTSPYPPLPKEKLNP-----PTPSIYLENKRDAFFPPLHQ 794

  Fly   401 YDLAELVKPNRMVKSNLVSAAEALGNKMQASKG 433
            :    .:.|     .|.|:....|...::...|
Mouse   795 F----CINP-----KNPVTVIRGLAGALKLDLG 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 14/66 (21%)
TPR repeat 229..257 CDD:276809 4/28 (14%)
TPR repeat 262..293 CDD:276809 9/30 (30%)
TPR_11 266..329 CDD:290150 16/72 (22%)
TPR 266..297 CDD:197478 6/30 (20%)
TPR repeat 298..326 CDD:276809 10/31 (32%)
UtyXP_017174175.1 TPR repeat 88..116 CDD:276809
TPR repeat 121..178 CDD:276809
TPR 130..397 CDD:223533 2/2 (100%)
TPR repeat 183..213 CDD:276809
TPR repeat 224..252 CDD:276809
TPR repeat 262..297 CDD:276809
TPR repeat 304..331 CDD:276809
TPR repeat 336..366 CDD:276809
TPR repeat 371..399 CDD:276809 2/4 (50%)
JmjC 935..999 CDD:214721
JmjC 969..1077 CDD:334913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.