DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Spag1 and Kdm6b

DIOPT Version :9

Sequence 1:	NP_651514.1	Gene:	Spag1 / 43239	FlyBaseID:	FBgn0039463	Length:	469	Species:	Drosophila melanogaster
Sequence 2:	XP_030101676.1	Gene:	Kdm6b / 216850	MGIID:	2448492	Length:	1642	Species:	Mus musculus

Alignment Length:	155	Identity:	31/155 - (20%)
Similarity:	45/155 - (29%)	Gaps:	64/155 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly   319 NVYKKLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRLIIEEIDPP------------------- 364
            |:.|.|     |.:|.|:..::.....| |||....:.....:.||
Mouse   699 NIMKML-----DESIRKEEEQQQQQEAG-VAPPPPLKEPFASLQPPFPSDTAPATTTAAPTTATT 757

  Fly   365 -QLKTSEPKKEAEKSEPTVVKKPEPVVSAKKPPPIKDYDLAELVKPNRMVKSNLVSAAEALGNKM 428
             ...|:...:|.||..|..:..|.|:  ||.|||.:
Mouse   758 TTTTTTTTTQEEEKKPPPALPPPPPL--AKFPPPPQ----------------------------- 791

  Fly   429 QASKGGAPKKPQSPPMTPKETLLRL 453
                   |:.|..||.:|...|..|
Mouse   792 -------PQPPPPPPASPASLLKSL 809

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Spag1	NP_651514.1	TPR_11	229..295	CDD:290150
		TPR repeat	229..257	CDD:276809
		TPR repeat	262..293	CDD:276809
		TPR_11	266..329	CDD:290150	3/9 (33%)
		TPR	266..297	CDD:197478
		TPR repeat	298..326	CDD:276809	3/6 (50%)
Kdm6b	XP_030101676.1	TPR repeat	106..136	CDD:276809
		JmjC	1342..1406	CDD:214721
		JmjC	1376..1484	CDD:396791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900