| Sequence 1: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_766114.1 | Gene: | Ttc24 / 214191 | MGIID: | 2443841 | Length: | 334 | Species: | Mus musculus |
| Alignment Length: | 264 | Identity: | 57/264 - (21%) |
|---|---|---|---|
| Similarity: | 98/264 - (37%) | Gaps: | 61/264 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 217 LKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYF 281
Fly 282 SAISDCQACLQI--DPMNIKAHLRMAEAHNAE----GKHLESLNVYKK---LLDFEPDNAIAKKA 337
Fly 338 VEKLT-SMLGEVAPSSATRLIIEEIDPPQLKTSEPKK-----------------EAEKSEPTVVK 384
Fly 385 KP-EPVV-------------------SAKKPPPIKDYDLAELVKPNRM-VKSNLVSAAEALGNKM 428
Fly 429 QASK 432 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Spag1 | NP_651514.1 | TPR_11 | 229..295 | CDD:290150 | 12/67 (18%) |
| TPR repeat | 229..257 | CDD:276809 | 6/27 (22%) | ||
| TPR repeat | 262..293 | CDD:276809 | 4/30 (13%) | ||
| TPR_11 | 266..329 | CDD:290150 | 15/71 (21%) | ||
| TPR | 266..297 | CDD:197478 | 6/32 (19%) | ||
| TPR repeat | 298..326 | CDD:276809 | 9/34 (26%) | ||
| Ttc24 | NP_766114.1 | TPR 1 | 35..68 | ||
| TPR repeat | 38..66 | CDD:276809 | |||
| TPR_12 | 68..144 | CDD:290160 | 15/78 (19%) | ||
| TPR 2 | 72..105 | 8/38 (21%) | |||
| TPR repeat | 72..100 | CDD:276809 | 8/33 (24%) | ||
| TPR repeat | 111..141 | CDD:276809 | 4/30 (13%) | ||
| TPR 3 | 112..145 | 5/33 (15%) | |||
| TPR_12 | 113..183 | CDD:290160 | 15/69 (22%) | ||
| TPR 4 | 152..185 | 8/32 (25%) | |||
| TPR_1 | 152..184 | CDD:278916 | 8/31 (26%) | ||
| TPR repeat | 152..180 | CDD:276809 | 7/27 (26%) | ||
| TPR_12 | 158..214 | CDD:290160 | 15/56 (27%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 220..258 | 9/37 (24%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||