DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and rpap-3

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_501282.1 Gene:rpap-3 / 183187 WormBaseID:WBGene00016375 Length:297 Species:Caenorhabditis elegans


Alignment Length:226 Identity:61/226 - (26%)
Similarity:97/226 - (42%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 EKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQ 288
            |:::.|:|.:.:|||:||.|:|..|:..|:.|:.:.|:..|  ::|||.|.|.......|..||.
 Worm     3 EEKKIAQRLKEQGNEAFKKKKYHKAMTIYSKSLEHWPDPIV--FSNRAQAGLNADLPLLAQIDCT 65

  Fly   289 ACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVY-------KKLLDFEPDNAIAKKAVEKLTSMLG 346
            |.|.:|....||:.|.|:|..|       |.:|       |....:..|..:.::|    ..:.|
 Worm    66 AALNLDSTAAKAYYRRAQAFKA-------LELYELAERDMKTCFKYSNDPNMERQA----NDLKG 119

  Fly   347 EVAPSSATRLIIEEIDPPQLKTSEPKKEAEK-------------SEPTVVKKPE-----PVVSAK 393
                    :..::.||.|.::..|..:..||             .|..|.::||     |....|
 Worm   120 --------KKNVQVIDLPSIERDEYLQSDEKFTKIDFTYNIEKIEEIIVAEEPENDNIVPKYITK 176

  Fly   394 KPPPIKDYDLAELVKPNRMVK--SNLVSAAE 422
            .||..|||.  :.|....|:|  .:|:..||
 Worm   177 LPPHPKDYQ--DFVGAVNMLKRAQSLLPLAE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 24/65 (37%)
TPR repeat 229..257 CDD:276809 12/27 (44%)
TPR repeat 262..293 CDD:276809 11/30 (37%)
TPR_11 266..329 CDD:290150 20/69 (29%)
TPR 266..297 CDD:197478 11/30 (37%)
TPR repeat 298..326 CDD:276809 9/34 (26%)
rpap-3NP_501282.1 3a0801s09 2..>98 CDD:273380 34/103 (33%)
TPR repeat 8..36 CDD:276809 12/27 (44%)
TPR repeat 40..70 CDD:276809 11/31 (35%)
TPR repeat 75..103 CDD:276809 9/34 (26%)
RPAP3_C 180..271 CDD:372776 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153676at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.