DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spag1 and F32D1.3

DIOPT Version :9

Sequence 1:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_504200.1 Gene:F32D1.3 / 178832 WormBaseID:WBGene00017983 Length:774 Species:Caenorhabditis elegans


Alignment Length:216 Identity:48/216 - (22%)
Similarity:83/216 - (38%) Gaps:51/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 NEERDQEQREK-----IISNHSKSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGN 237
            ||..|::..||     |..||..|..|              .|.||               :|.|
 Worm   598 NELGDEQSAEKFFGKAIGENHVNSYLT--------------MAHLK---------------IRQN 633

  Fly   238 ESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHL 302
            .||   |.||.:.:   ::...|| :|....|.|:|...::.|..::...:..|.:||.::.:..
 Worm   634 RSF---EVENLLRK---AMTLAPE-SVTVLQNIALAEFHMQNYNRSLLFYRKALHLDPTHLDSLQ 691

  Fly   303 RMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKK---AVEKLTSMLGEVAPSSATRLIIEEIDPP 364
            .:|........|:||...|:|:::.:|::..|..   |:..|..............||   :|| 
 Worm   692 GIANLLQQTQNHVESETFYRKVMEAQPNSYAAHANYGAILHLNQKYDLALKEYEIALI---LDP- 752

  Fly   365 QLKTSEPKKEAEKSEPTVVKK 385
               ||:..:|..|....::::
 Worm   753 ---TSDVARENRKKVIRILRR 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 15/65 (23%)
TPR repeat 229..257 CDD:276809 7/27 (26%)
TPR repeat 262..293 CDD:276809 6/30 (20%)
TPR_11 266..329 CDD:290150 13/62 (21%)
TPR 266..297 CDD:197478 7/30 (23%)
TPR repeat 298..326 CDD:276809 6/27 (22%)
F32D1.3NP_504200.1 DUF1736 244..316 CDD:369859
TPR repeat 436..464 CDD:276809
TPR 448..748 CDD:223533 40/185 (22%)
TPR repeat 469..498 CDD:276809
TPR repeat 504..531 CDD:276809
TPR repeat 537..578 CDD:276809
TPR repeat 587..614 CDD:276809 5/15 (33%)
TPR repeat 619..647 CDD:276809 12/62 (19%)
TPR repeat 655..681 CDD:276809 4/25 (16%)
TPR repeat 686..716 CDD:276809 6/29 (21%)
TPR repeat 721..748 CDD:276809 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.