Sequence 1: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_940863.3 | Gene: | LONRF2 / 164832 | HGNCID: | 24788 | Length: | 754 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 57/267 - (21%) |
---|---|---|---|
Similarity: | 102/267 - (38%) | Gaps: | 71/267 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 RLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLK 276
Fly 277 LKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPD-NAIAKKAVEK 340
Fly 341 LTSML--------GEVAPSSATRL------------IIEEIDPPQLKTS---------------- 369
Fly 370 --------EPKKEAEKSEPTVVKKPEPVVSAKKPPPIKDYDLAELVKPNRMVKSNLVSAAEALGN 426
Fly 427 KMQASKG 433 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Spag1 | NP_651514.1 | TPR_11 | 229..295 | CDD:290150 | 13/65 (20%) |
TPR repeat | 229..257 | CDD:276809 | 4/27 (15%) | ||
TPR repeat | 262..293 | CDD:276809 | 8/30 (27%) | ||
TPR_11 | 266..329 | CDD:290150 | 19/62 (31%) | ||
TPR | 266..297 | CDD:197478 | 10/30 (33%) | ||
TPR repeat | 298..326 | CDD:276809 | 8/27 (30%) | ||
LONRF2 | NP_940863.3 | TPR 1 | 23..58 | ||
TPR_16 | 27..92 | CDD:372602 | |||
TPR 2 | 59..91 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..136 | ||||
RING1-HC_LONFs | 143..174 | CDD:319427 | |||
TPR 3 | 197..230 | 8/33 (24%) | |||
TPR repeat | 200..225 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 230..260 | CDD:276809 | 9/46 (20%) | ||
TPR 4 | 231..264 | 11/49 (22%) | |||
TPR repeat | 265..293 | CDD:276809 | 8/27 (30%) | ||
TPR 5 | 266..298 | 9/31 (29%) | |||
PEX10 | <380..489 | CDD:227861 | 17/66 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 398..439 | 9/41 (22%) | |||
RING2-HC_LONFs | 446..487 | CDD:319428 | |||
TPR 6 | 447..483 | ||||
RING-HC finger (C3HC4-type) | 449..486 | CDD:319428 | |||
LON_substr_bdg | 538..738 | CDD:366967 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |